BDGP Sequence Production Resources |
Search the DGRC for IP16167
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 161 |
Well: | 67 |
Vector: | pOT2 |
Associated Gene/Transcript | GluClalpha-RE |
Protein status: | IP16167.pep: gold |
Sequenced Size: | 940 |
Gene | Date | Evidence |
---|---|---|
GluClalpha | 2008-04-29 | Release 5.5 accounting |
GluClalpha | 2008-08-15 | Release 5.9 accounting |
GluClalpha | 2008-12-18 | 5.12 accounting |
940 bp (940 high quality bases) assembled on 2006-06-13
GenBank Submission: BT028797
> IP16167.complete ATTCGGCACGAGGAGAAAAGGAGAAAAAAGTCTTAGATCAAATTTTAGGT GCAGGCAAATACGACGCCCGAATACGACCATCTGGAATAAATGGCACAGG AGTACAGTGTGCAGTTAACCTTCCGTGAACAGTGGACGGATGAACGCCTC AAGTTCGACGATATCCAGGGTCGCCTAAAGTATCTGACCCTGACGGAGGC GAACCGCGTGTGGATGCCCGATCTTTTCTTCTCGAACGAGAAGGAGGGAC ACTTCCACAACATCATCATGCCCAATGTGTATATTCGCATCTTCCCCAAC GGATCTGTGCTATATAGTATACGTATCTCGCTGACATTGGCCTGCCCAAT GAACCTAAAGCTGTATCCGCTGGATAGACAGATCTGCTCACTACGGATGG CCAGCTATGGCTGGACCACCAACGACTTGGTCTTCCTGTGGAAGGAGGGC GATCCCGTACAGGTGGTAAAGAACTTACACCTACCTCGCTTCACACTGGA GAAGTTTCTGACTGATTACTGTAACAGTAAAACCAACACCGGTGAATACA GTTGCCTCAAAGTCGATCTACTATTCAAGCGAGAATTCTCATATTACTTA ATACAAATTTATATACCATGCTGTATGTTGGTCATTGTATCATGGGTATC ATTCTGGCTGGATCAAGGAGCAGTACCGGCGCGAGTGTCACTGGGTGTCA CCACCCTGCTGACCATGGCCACCCAGACGTCGGGCATAAACGCCTCCCTG CCGCCCGTTTCCTATACGAAGGCCATCGATGTGTGGACAGGCGTGTGTCT GACGTTCGTGTTCGGGGCCCTGCTCGAGTTCGCCCTGGTGAACTATGCAT CCCGATCAGGTTCGAATAAAGCTAGTAATTGAACTTTTATATGCTTCTTA ACCACGTATAAATGTTAATTAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
GluClalpha.g | 1708 | GluClalpha.g | 665..1488 | 99..922 | 4120 | 100 | Plus |
GluClalpha.m | 2072 | GluClalpha.m | 1060..1883 | 99..922 | 4120 | 100 | Plus |
GluClalpha.j | 3038 | GluClalpha.j | 1060..1883 | 99..922 | 4120 | 100 | Plus |
GluClalpha.g | 1708 | GluClalpha.g | 508..594 | 13..99 | 435 | 100 | Plus |
GluClalpha.m | 2072 | GluClalpha.m | 903..989 | 13..99 | 435 | 100 | Plus |
GluClalpha.j | 3038 | GluClalpha.j | 903..989 | 13..99 | 435 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 15584280..15584517 | 169..406 | 1190 | 100 | Plus |
chr3R | 27901430 | chr3R | 15588133..15588359 | 694..920 | 1135 | 100 | Plus |
chr3R | 27901430 | chr3R | 15587482..15587637 | 541..696 | 780 | 100 | Plus |
chr3R | 27901430 | chr3R | 15584786..15584922 | 407..543 | 685 | 100 | Plus |
chr3R | 27901430 | chr3R | 15577661..15577748 | 13..100 | 440 | 100 | Plus |
chr3R | 27901430 | chr3R | 15584146..15584222 | 95..171 | 385 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 19760394..19760631 | 169..406 | 1190 | 100 | Plus |
3R | 32079331 | 3R | 19764248..19764476 | 694..922 | 1145 | 100 | Plus |
3R | 32079331 | 3R | 19763597..19763752 | 541..696 | 780 | 100 | Plus |
3R | 32079331 | 3R | 19760900..19761036 | 407..543 | 685 | 100 | Plus |
3R | 32079331 | 3R | 19753774..19753861 | 13..100 | 440 | 100 | Plus |
3R | 32079331 | 3R | 19760260..19760336 | 95..171 | 385 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 19501225..19501462 | 169..406 | 1190 | 100 | Plus |
3R | 31820162 | 3R | 19505079..19505307 | 694..922 | 1145 | 100 | Plus |
3R | 31820162 | 3R | 19504428..19504583 | 541..696 | 780 | 100 | Plus |
3R | 31820162 | 3R | 19501731..19501867 | 407..543 | 685 | 100 | Plus |
3R | 31820162 | 3R | 19494605..19494692 | 13..100 | 440 | 100 | Plus |
3R | 31820162 | 3R | 19501091..19501167 | 95..171 | 385 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 7002..7043 | 235..276 | 111 | 73.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 15577661..15577747 | 13..99 | 100 | -> | Plus |
chr3R | 15584151..15584220 | 100..169 | 100 | -> | Plus |
chr3R | 15584281..15584517 | 170..406 | 100 | -> | Plus |
chr3R | 15584786..15584920 | 407..541 | 100 | -> | Plus |
chr3R | 15587483..15587635 | 542..694 | 100 | -> | Plus |
chr3R | 15588134..15588359 | 695..920 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RD | 89..178 | 13..102 | 97 | -> | Plus |
GluClalpha-RD | 247..1018 | 103..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RD | 89..178 | 13..102 | 97 | -> | Plus |
GluClalpha-RD | 247..1018 | 103..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RE | 1..792 | 91..882 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RD | 89..178 | 13..102 | 97 | -> | Plus |
GluClalpha-RD | 247..1018 | 103..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RE | 1..792 | 91..882 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RD | 499..588 | 13..102 | 97 | -> | Plus |
GluClalpha-RD | 657..1428 | 103..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RE | 499..1406 | 13..920 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RE | 499..1406 | 13..920 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RD | 499..588 | 13..102 | 97 | -> | Plus |
GluClalpha-RD | 657..1428 | 103..874 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GluClalpha-RE | 743..1650 | 13..920 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19753774..19753860 | 13..99 | 100 | -> | Plus |
3R | 19760265..19760334 | 100..169 | 100 | -> | Plus |
3R | 19760395..19760631 | 170..406 | 100 | -> | Plus |
3R | 19760900..19761034 | 407..541 | 100 | -> | Plus |
3R | 19763598..19763750 | 542..694 | 100 | -> | Plus |
3R | 19764249..19764474 | 695..920 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19753774..19753860 | 13..99 | 100 | -> | Plus |
3R | 19760265..19760334 | 100..169 | 100 | -> | Plus |
3R | 19760395..19760631 | 170..406 | 100 | -> | Plus |
3R | 19760900..19761034 | 407..541 | 100 | -> | Plus |
3R | 19763598..19763750 | 542..694 | 100 | -> | Plus |
3R | 19764249..19764474 | 695..920 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19753774..19753860 | 13..99 | 100 | -> | Plus |
3R | 19760265..19760334 | 100..169 | 100 | -> | Plus |
3R | 19760395..19760631 | 170..406 | 100 | -> | Plus |
3R | 19760900..19761034 | 407..541 | 100 | -> | Plus |
3R | 19763598..19763750 | 542..694 | 100 | -> | Plus |
3R | 19764249..19764474 | 695..920 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 15579496..15579582 | 13..99 | 100 | -> | Plus |
arm_3R | 15585987..15586056 | 100..169 | 100 | -> | Plus |
arm_3R | 15586117..15586353 | 170..406 | 100 | -> | Plus |
arm_3R | 15586622..15586756 | 407..541 | 100 | -> | Plus |
arm_3R | 15589320..15589472 | 542..694 | 100 | -> | Plus |
arm_3R | 15589971..15590196 | 695..920 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19494605..19494691 | 13..99 | 100 | -> | Plus |
3R | 19501096..19501165 | 100..169 | 100 | -> | Plus |
3R | 19501226..19501462 | 170..406 | 100 | -> | Plus |
3R | 19501731..19501865 | 407..541 | 100 | -> | Plus |
3R | 19504429..19504581 | 542..694 | 100 | -> | Plus |
3R | 19505080..19505305 | 695..920 | 100 | Plus |
Translation from 90 to 881
> IP16167.pep MAQEYSVQLTFREQWTDERLKFDDIQGRLKYLTLTEANRVWMPDLFFSNE KEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICS LRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKFLTDYCNSKTNT GEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVS LGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALV NYASRSGSNKASN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17614-PA | 498 | GF17614-PA | 128..386 | 4..262 | 1389 | 99.2 | Plus |
Dana\GF17611-PA | 485 | GF17611-PA | 74..321 | 5..251 | 548 | 41.5 | Plus |
Dana\GF18400-PA | 426 | GF18400-PA | 101..348 | 5..251 | 541 | 39.9 | Plus |
Dana\GF23583-PA | 637 | GF23583-PA | 104..403 | 4..255 | 504 | 36.3 | Plus |
Dana\GF24205-PA | 513 | GF24205-PA | 106..364 | 7..259 | 432 | 36.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23471-PA | 453 | GG23471-PA | 83..341 | 4..262 | 1392 | 99.6 | Plus |
Dere\GG23438-PA | 484 | GG23438-PA | 74..321 | 5..251 | 548 | 41.5 | Plus |
Dere\GG17931-PA | 496 | GG17931-PA | 84..342 | 4..252 | 544 | 40 | Plus |
Dere\GG18454-PA | 422 | GG18454-PA | 101..348 | 5..251 | 540 | 39.9 | Plus |
Dere\GG15035-PA | 631 | GG15035-PA | 103..402 | 4..255 | 503 | 36.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15301-PA | 456 | GH15301-PA | 79..340 | 1..262 | 1383 | 98.1 | Plus |
Dgri\GH14967-PA | 482 | GH14967-PA | 74..321 | 5..251 | 549 | 41.5 | Plus |
Dgri\GH11877-PA | 497 | GH11877-PA | 84..343 | 4..252 | 543 | 39.8 | Plus |
Dgri\GH17342-PA | 425 | GH17342-PA | 103..350 | 5..251 | 539 | 39.9 | Plus |
Dgri\GH12851-PA | 552 | GH12851-PA | 108..364 | 4..260 | 498 | 38.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
GluClalpha-PE | 263 | CG7535-PE | 1..263 | 1..263 | 1394 | 100 | Plus |
GluClalpha-PP | 456 | CG7535-PP | 79..340 | 1..262 | 1372 | 98.5 | Plus |
GluClalpha-PN | 463 | CG7535-PN | 79..340 | 1..262 | 1372 | 98.5 | Plus |
GluClalpha-PI | 456 | CG7535-PI | 79..340 | 1..262 | 1372 | 98.5 | Plus |
GluClalpha-PM | 456 | CG7535-PM | 82..340 | 4..262 | 1371 | 99.6 | Plus |
GluClalpha-PJ | 457 | CG7535-PJ | 83..341 | 4..262 | 1371 | 99.6 | Plus |
GluClalpha-PH | 447 | CG7535-PH | 79..338 | 1..260 | 1350 | 97.7 | Plus |
GluClalpha-PL | 448 | CG7535-PL | 83..339 | 4..260 | 1349 | 98.8 | Plus |
GluClalpha-PK | 447 | CG7535-PK | 82..338 | 4..260 | 1349 | 98.8 | Plus |
GluClalpha-PO | 455 | CG7535-PO | 79..334 | 1..256 | 1346 | 98.8 | Plus |
GluClalpha-PF | 349 | CG7535-PF | 79..334 | 1..256 | 1346 | 98.8 | Plus |
Rdl-PF | 606 | CG10537-PF | 103..356 | 4..255 | 571 | 43.3 | Plus |
Rdl-PE | 606 | CG10537-PE | 103..356 | 4..255 | 571 | 43.3 | Plus |
Rdl-PA | 606 | CG10537-PA | 103..356 | 4..255 | 571 | 43.3 | Plus |
Rdl-PD | 579 | CG10537-PD | 103..356 | 4..255 | 569 | 42.5 | Plus |
Rdl-PC | 606 | CG10537-PC | 103..356 | 4..255 | 569 | 42.5 | Plus |
Rdl-PG | 608 | CG10537-PG | 103..356 | 4..255 | 569 | 42.5 | Plus |
ort-PA | 485 | CG7411-PA | 74..321 | 5..251 | 546 | 41.5 | Plus |
Lcch3-PC | 496 | CG17336-PC | 84..342 | 4..252 | 541 | 40 | Plus |
HisCl1-PB | 422 | CG14723-PB | 101..348 | 5..251 | 540 | 39.9 | Plus |
HisCl1-PA | 426 | CG14723-PA | 101..348 | 5..251 | 540 | 39.9 | Plus |
HisCl1-PD | 416 | CG14723-PD | 101..342 | 5..251 | 522 | 39.5 | Plus |
CG8916-PC | 510 | CG8916-PC | 51..308 | 4..261 | 484 | 37.2 | Plus |
CG8916-PB | 612 | CG8916-PB | 153..410 | 4..261 | 484 | 37.2 | Plus |
pHCl-1-PD | 737 | CG44099-PD | 382..633 | 4..255 | 439 | 36.2 | Plus |
pHCl-1-PL | 747 | CG44099-PL | 375..626 | 4..255 | 439 | 36.2 | Plus |
pHCl-1-PQ | 747 | CG44099-PQ | 375..626 | 4..255 | 439 | 36.2 | Plus |
pHCl-1-PP | 754 | CG44099-PP | 400..651 | 4..255 | 439 | 36.2 | Plus |
pHCl-1-PH | 762 | CG44099-PH | 407..658 | 4..255 | 439 | 36.2 | Plus |
pHCl-1-PJ | 772 | CG44099-PJ | 400..651 | 4..255 | 439 | 36.2 | Plus |
pHCl-1-PM | 954 | CG44099-PM | 400..651 | 4..255 | 439 | 36.2 | Plus |
pHCl-1-PN | 978 | CG44099-PN | 407..658 | 4..255 | 439 | 36.2 | Plus |
pHCl-1-PG | 681 | CG44099-PG | 407..658 | 4..255 | 437 | 35.8 | Plus |
pHCl-1-PK | 746 | CG44099-PK | 375..626 | 4..255 | 437 | 35.8 | Plus |
pHCl-1-PI | 754 | CG44099-PI | 382..633 | 4..255 | 437 | 35.8 | Plus |
pHCl-1-PE | 762 | CG44099-PE | 407..658 | 4..255 | 437 | 35.8 | Plus |
pHCl-1-PR | 762 | CG44099-PR | 407..658 | 4..255 | 437 | 35.8 | Plus |
pHCl-1-PF | 779 | CG44099-PF | 407..658 | 4..255 | 437 | 35.8 | Plus |
pHCl-1-PO | 929 | CG44099-PO | 375..626 | 4..255 | 437 | 35.8 | Plus |
CG6927-PA | 524 | CG6927-PA | 87..346 | 4..251 | 408 | 32.7 | Plus |
CG7589-PB | 509 | CG7589-PB | 95..360 | 4..259 | 407 | 32.8 | Plus |
CG7589-PA | 509 | CG7589-PA | 95..360 | 4..259 | 407 | 32.8 | Plus |
pHCl-2-PB | 526 | CG11340-PB | 123..382 | 4..251 | 379 | 33.1 | Plus |
pHCl-2-PA | 526 | CG11340-PA | 123..382 | 4..251 | 379 | 33.1 | Plus |
CG12344-PD | 445 | CG12344-PD | 78..328 | 4..250 | 349 | 31.6 | Plus |
CG12344-PB | 445 | CG12344-PB | 78..328 | 4..250 | 349 | 31.6 | Plus |
CG12344-PC | 449 | CG12344-PC | 78..328 | 4..250 | 349 | 31.6 | Plus |
CG12344-PA | 449 | CG12344-PA | 78..328 | 4..250 | 349 | 31.6 | Plus |
Grd-PA | 686 | CG7446-PA | 154..285 | 5..136 | 303 | 41.4 | Plus |
Grd-PA | 686 | CG7446-PA | 377..485 | 152..260 | 256 | 45 | Plus |
HisCl1-PC | 233 | CG14723-PC | 101..208 | 5..111 | 187 | 31.5 | Plus |
nAChRalpha6-PH | 494 | CG4128-PH | 85..328 | 14..256 | 170 | 24.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22423-PA | 493 | GI22423-PA | 123..381 | 4..262 | 1386 | 99.2 | Plus |
Dmoj\GI22418-PA | 482 | GI22418-PA | 74..321 | 5..251 | 548 | 41.5 | Plus |
Dmoj\GI15665-PA | 498 | GI15665-PA | 85..344 | 4..252 | 548 | 40.2 | Plus |
Dmoj\GI22447-PA | 425 | GI22447-PA | 103..350 | 5..251 | 540 | 39.9 | Plus |
Dmoj\GI12687-PA | 609 | GI12687-PA | 103..402 | 4..255 | 503 | 36.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12670-PA | 458 | GL12670-PA | 79..342 | 1..262 | 1333 | 94.3 | Plus |
Dper\GL12390-PA | 423 | GL12390-PA | 101..348 | 5..251 | 539 | 39.9 | Plus |
Dper\GL25394-PA | 453 | GL25394-PA | 10..266 | 4..260 | 504 | 38.8 | Plus |
Dper\GL15583-PA | 511 | GL15583-PA | 99..364 | 4..259 | 436 | 34.7 | Plus |
Dper\GL13104-PA | 544 | GL13104-PA | 87..354 | 4..259 | 401 | 31.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20421-PE | 342 | GA20421-PE | 83..342 | 4..263 | 1396 | 99.6 | Plus |
Dpse\GA20421-PD | 274 | GA20421-PD | 15..274 | 4..263 | 1392 | 99.6 | Plus |
Dpse\GA20421-PA | 456 | GA20421-PA | 79..340 | 1..262 | 1387 | 98.1 | Plus |
Dpse\GA20421-PB | 452 | GA20421-PB | 82..340 | 4..262 | 1386 | 99.2 | Plus |
Dpse\GA20421-PF | 422 | GA20421-PF | 59..306 | 13..262 | 1311 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26860-PA | 456 | GM26860-PA | 79..340 | 1..262 | 1391 | 98.5 | Plus |
Dsec\GM26856-PA | 485 | GM26856-PA | 74..321 | 5..251 | 548 | 41.5 | Plus |
Dsec\GM23979-PA | 426 | GM23979-PA | 101..348 | 5..251 | 540 | 39.9 | Plus |
Dsec\GM24889-PA | 631 | GM24889-PA | 103..402 | 4..255 | 503 | 36.3 | Plus |
Dsec\GM22598-PA | 510 | GM22598-PA | 51..308 | 4..261 | 480 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19310-PA | 448 | GD19310-PA | 82..334 | 4..262 | 1154 | 87.4 | Plus |
Dsim\ort-PA | 485 | GD19307-PA | 74..321 | 5..251 | 548 | 41.5 | Plus |
Dsim\GD24824-PA | 496 | GD24824-PA | 84..342 | 4..252 | 544 | 40 | Plus |
Dsim\GD24823-PA | 512 | GD24823-PA | 51..308 | 4..261 | 484 | 37.2 | Plus |
Dsim\GD14708-PA | 509 | GD14708-PA | 95..360 | 4..259 | 411 | 32.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10981-PA | 456 | GJ10981-PA | 79..340 | 1..262 | 1383 | 98.1 | Plus |
Dvir\ort-PA | 482 | GJ10978-PA | 74..321 | 5..251 | 548 | 41.5 | Plus |
Dvir\GJ19199-PA | 497 | GJ19199-PA | 84..343 | 4..252 | 547 | 40.2 | Plus |
Dvir\GJ11009-PA | 425 | GJ11009-PA | 103..350 | 5..251 | 539 | 39.9 | Plus |
Dvir\GJ12672-PA | 607 | GJ12672-PA | 103..402 | 4..255 | 503 | 36.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22351-PA | 454 | GK22351-PA | 79..338 | 1..262 | 1358 | 96.9 | Plus |
Dwil\GK22347-PA | 489 | GK22347-PA | 74..320 | 5..251 | 547 | 41.9 | Plus |
Dwil\GK17727-PA | 497 | GK17727-PA | 84..343 | 4..252 | 543 | 39.5 | Plus |
Dwil\GK12944-PA | 424 | GK12944-PA | 103..350 | 5..251 | 539 | 39.5 | Plus |
Dwil\GK24333-PA | 643 | GK24333-PA | 103..402 | 4..255 | 503 | 36.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25622-PA | 456 | GE25622-PA | 79..340 | 1..262 | 1391 | 98.5 | Plus |
Dyak\GE25619-PA | 485 | GE25619-PA | 74..321 | 5..251 | 548 | 41.5 | Plus |
Dyak\GE17238-PA | 496 | GE17238-PA | 84..342 | 4..252 | 544 | 40 | Plus |
Dyak\GE24203-PA | 422 | GE24203-PA | 101..348 | 5..251 | 540 | 39.9 | Plus |
Dyak\GE21259-PA | 663 | GE21259-PA | 135..434 | 4..255 | 504 | 36.3 | Plus |
Translation from 90 to 881
> IP16167.hyp MAQEYSVQLTFREQWTDERLKFDDIQGRLKYLTLTEANRVWMPDLFFSNE KEGHFHNIIMPNVYIRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICS LRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKFLTDYCNSKTNT GEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVS LGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALV NYASRSGSNKASN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
GluClalpha-PE | 263 | CG7535-PE | 1..263 | 1..263 | 1394 | 100 | Plus |
GluClalpha-PP | 456 | CG7535-PP | 79..340 | 1..262 | 1372 | 98.5 | Plus |
GluClalpha-PI | 456 | CG7535-PI | 79..340 | 1..262 | 1372 | 98.5 | Plus |
GluClalpha-PN | 463 | CG7535-PN | 79..340 | 1..262 | 1372 | 98.5 | Plus |
GluClalpha-PM | 456 | CG7535-PM | 82..340 | 4..262 | 1371 | 99.6 | Plus |