Clone IP16171 Report

Search the DGRC for IP16171

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:161
Well:71
Vector:pOT2
Associated Gene/TranscriptCG8628-RA
Protein status:IP16171.pep: Imported from assembly
Sequenced Size:428

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8628 2008-08-15 Release 5.9 accounting
CG8628 2008-12-18 5.12 accounting

Clone Sequence Records

IP16171.complete Sequence

428 bp assembled on 2020-02-20

GenBank Submission: BT033056

> IP16171.complete
CACCGCATTACCAACAAGAATCCTATACTAGCAACATGGTGTCGTTCGAG
GAAGCCACTGAACTCGCCAACAAGTTCACCAAGAAGCCCACGGATGCCGA
GTTCTTGGAATTCTACGGTCTCTTCAAGCAGGCCACCGTTGGCGATGTGA
ACATCGAGAAGCCCGGCGCTCTGGCTCTCAAGGACAAGGCCAAGTACGAG
GCCTGGAGCTCCAACAAGGGTCTCTCCAAGGAGGCTGCCAAGGAGGCCTA
CGTAAAGGTGTACGAGAAGTACGCCCCCAAGTACGCCTAAGCCGGCAACC
GATCAAATCCGATCCAATCCGATTCCGATTGCGGACCCCCCATGCACCTG
CCATCACCACTATAGTACTTAGTTGGACAATAAAGATTACCAGATATATG
AGCAATAAAAAAAAAAAAAAAAAAAAAA

IP16171.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8628-RA 682 CG8628-RA 61..468 1..408 2040 100 Plus
CG8628-RB 705 CG8628-RB 70..473 5..408 2020 100 Plus
CG8629-RA 348 CG8629-RA 44..287 48..291 830 89.3 Plus
Blast to d_melanogaster_OreR.fa performed 2020-02-20 10:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7123402..7123764 44..406 1800 99.7 Plus
chr3L 24539361 chr3L 7120242..7120485 291..48 815 88.9 Minus
chr3L 24539361 chr3L 7123230..7123269 5..44 200 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:27:27 has no hits.
Blast to dmel-all-transcript-r6.23.fasta performed 2020-02-20 10:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
Acbp3-RA 429 CG8628-RA 24..429 1..406 2030 100 Plus
Acbp3-RB 408 CG8628-RB 7..408 5..406 2010 100 Plus
Acbp4-RA 352 CG8629-RA 48..291 48..291 830 89.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2020-02-20 10:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7131143..7131507 44..408 1825 100 Plus
3L 28110227 3L 7127974..7128217 291..48 830 89.3 Minus
3L 28110227 3L 7130971..7131010 5..44 200 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7124243..7124607 44..408 1825 100 Plus
3L 28103327 3L 7121074..7121317 291..48 830 89.3 Minus
3L 28103327 3L 7124071..7124110 5..44 200 100 Plus
Blast to na_custom.ecoli performed on 2008-06-09 15:39:11 has no hits.
Blast to na_te.dros performed on 2020-02-20 10:22:19 has no hits.

IP16171.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2020-02-20 10:22:25 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7123228..7123269 1..44 95 -> Plus
chr3L 7123403..7123764 45..406 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:02:37 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 1..255 36..290 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:07:30 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 1..255 36..290 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:58 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RB 1..255 36..290 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:17:35 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 1..255 36..290 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:04:33 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RB 1..255 36..290 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:36:28 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 24..417 1..394 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:07:30 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 24..429 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:58 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 24..429 1..406 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:17:35 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 24..417 1..394 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:04:33 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
CG8628-RA 24..429 1..406 100   Plus
Sim4 to dmel-all-transcript-r6.23.fasta performed 2020-02-20 10:22:25 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
Acbp3-RA 24..429 1..406 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2020-02-20 10:22:25 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7131144..7131505 45..406 100   Plus
3L 7130969..7131010 1..44 95 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2020-02-20 10:22:25 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7131144..7131505 45..406 100   Plus
3L 7130969..7131010 1..44 95 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:58 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7124069..7124110 1..44 95 -> Plus
arm_3L 7124244..7124605 45..406 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:40:40 Download gff for IP16171.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7124069..7124110 1..44 95 -> Plus
3L 7124244..7124605 45..406 100   Plus

IP16171.hyp Sequence

Translation from 0 to 289

> IP16171.hyp
QHYQQESYTSNMVSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVN
IEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYVKVYEKYAPKYA*

IP16171.hyp Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2020-02-20 10:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Acbp3-PA 84 CG8628-PA 1..84 12..95 430 100 Plus
Acbp3-PB 84 CG8628-PB 1..84 12..95 430 100 Plus
Acbp4-PA 84 CG8629-PA 1..84 12..95 366 83.3 Plus
Acbp6-PB 82 CG15829-PB 1..81 12..94 219 53 Plus
Acbp6-PA 82 CG15829-PA 1..81 12..94 219 53 Plus
Acbp2-PA 86 CG8627-PA 6..86 15..95 213 51.9 Plus
Acbp2-PB 86 CG8627-PB 6..86 15..95 213 51.9 Plus
Acbp5-PA 82 CG5804-PA 1..81 12..94 205 51.8 Plus
Acbp1-PB 90 CG8498-PB 2..76 10..84 182 46.7 Plus
Acbp1-PA 90 CG8498-PA 2..76 10..84 182 46.7 Plus
anox-PB 243 CG33713-PB 13..92 15..94 140 37.5 Plus
anox-PA 243 CG33713-PA 13..92 15..94 140 37.5 Plus

IP16171.pep Sequence

Translation from 2 to 289

> IP16171.pep
PHYQQESYTSNMVSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVN
IEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYVKVYEKYAPKYA*

IP16171.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2020-02-20 10:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25010-PA 84 GF25010-PA 1..84 12..95 379 89.3 Plus
Dana\GF24791-PA 84 GF24791-PA 1..84 12..95 367 86.9 Plus
Dana\GF25009-PA 82 GF25009-PA 1..81 12..94 210 55.4 Plus
Dana\GF25011-PA 85 GF25011-PA 5..85 15..95 203 53.1 Plus
Dana\GF10147-PA 82 GF10147-PA 1..82 12..95 192 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2020-02-20 10:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14405-PA 84 GG14405-PA 1..84 12..95 401 95.2 Plus
Dere\GG14997-PA 84 GG14997-PA 1..84 12..95 367 86.9 Plus
Dere\GG14406-PA 86 GG14406-PA 1..86 12..95 209 52.3 Plus
Dere\GG14404-PA 82 GG14404-PA 1..81 12..94 200 51.8 Plus
Dere\GG15060-PA 82 GG15060-PA 1..82 12..95 195 53.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2020-02-20 10:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17042-PA 84 GH17042-PA 1..84 12..95 363 84.5 Plus
Dgri\GH16140-PA 84 GH16140-PA 1..84 12..95 284 65.5 Plus
Dgri\GH14516-PA 82 GH14516-PA 1..81 12..94 212 54.2 Plus
Dgri\GH16139-PA 81 GH16139-PA 1..80 13..94 207 51.2 Plus
Dgri\GH13894-PA 81 GH13894-PA 1..80 13..94 207 51.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2020-02-20 10:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Acbp3-PA 84 CG8628-PA 1..84 12..95 430 100 Plus
Acbp3-PB 84 CG8628-PB 1..84 12..95 430 100 Plus
Acbp4-PA 84 CG8629-PA 1..84 12..95 366 83.3 Plus
Acbp6-PB 82 CG15829-PB 1..81 12..94 219 53 Plus
Acbp6-PA 82 CG15829-PA 1..81 12..94 219 53 Plus
Acbp2-PA 86 CG8627-PA 6..86 15..95 213 51.9 Plus
Acbp2-PB 86 CG8627-PB 6..86 15..95 213 51.9 Plus
Acbp5-PA 82 CG5804-PA 1..81 12..94 205 51.8 Plus
Acbp1-PB 90 CG8498-PB 2..76 10..84 182 46.7 Plus
Acbp1-PA 90 CG8498-PA 2..76 10..84 182 46.7 Plus
anox-PB 243 CG33713-PB 13..92 15..94 140 37.5 Plus
anox-PA 243 CG33713-PA 13..92 15..94 140 37.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2020-02-20 10:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13295-PA 87 GI13295-PA 7..87 15..95 210 55.6 Plus
Dmoj\GI13294-PA 82 GI13294-PA 1..81 12..94 185 51.8 Plus
Dmoj\GI17002-PA 90 GI17002-PA 2..76 10..84 182 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2020-02-20 10:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25027-PA 84 GL25027-PA 1..84 12..95 375 89.3 Plus
Dper\GL25142-PA 84 GL25142-PA 1..84 12..95 355 82.1 Plus
Dper\GL25029-PA 87 GL25029-PA 7..87 15..95 213 55.6 Plus
Dper\GL25026-PA 82 GL25026-PA 1..78 12..91 194 52.5 Plus
Dper\GL19321-PA 90 GL19321-PA 7..76 15..84 184 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2020-02-20 10:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23591-PA 84 GA23591-PA 1..84 12..95 375 89.3 Plus
Dpse\GA21220-PA 84 GA21220-PA 1..84 12..95 355 82.1 Plus
Dpse\GA21218-PA 87 GA21218-PA 7..87 15..95 213 55.6 Plus
Dpse\GA13977-PA 82 GA13977-PA 1..78 12..91 194 52.5 Plus
Dpse\GA21120-PA 90 GA21120-PA 7..76 15..84 183 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2020-02-20 10:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14821-PA 84 GM14821-PA 1..84 12..95 413 98.8 Plus
Dsec\GM13788-PA 84 GM13788-PA 1..84 12..95 356 83.3 Plus
Dsec\GM14822-PA 86 GM14822-PA 1..86 12..95 208 52.3 Plus
Dsec\GM14820-PA 82 GM14820-PA 1..81 12..94 207 54.2 Plus
Dsec\GM24916-PA 81 GM24916-PA 13..81 25..95 184 56.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2020-02-20 10:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13994-PA 84 GD13994-PA 1..84 12..95 413 98.8 Plus
Dsim\GD13089-PA 84 GD13089-PA 1..84 12..95 356 83.3 Plus
Dsim\GD13995-PA 86 GD13995-PA 1..86 12..95 211 53.5 Plus
Dsim\GD13993-PA 82 GD13993-PA 1..81 12..94 207 54.2 Plus
Dsim\GD12963-PA 82 GD12963-PA 1..82 12..95 190 51.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2020-02-20 10:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13316-PA 84 GJ13316-PA 1..84 12..95 350 81 Plus
Dvir\GJ12299-PA 83 GJ12299-PA 1..83 13..95 267 65.1 Plus
Dvir\GJ12298-PA 81 GJ12298-PA 1..80 13..94 209 51.2 Plus
Dvir\GJ12060-PA 82 GJ12060-PA 1..81 12..94 207 54.2 Plus
Dvir\GJ12061-PA 87 GJ12061-PA 7..87 15..95 201 53.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2020-02-20 10:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17538-PA 84 GK17538-PA 1..84 12..95 359 82.1 Plus
Dwil\GK19286-PA 81 GK19286-PA 1..81 15..95 269 66.7 Plus
Dwil\GK16653-PA 87 GK16653-PA 7..87 15..95 219 56.8 Plus
Dwil\GK19285-PA 79 GK19285-PA 1..79 15..95 211 56.8 Plus
Dwil\GK23743-PA 90 GK23743-PA 2..76 10..84 189 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2020-02-20 10:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21595-PA 84 GE21595-PA 1..84 12..95 408 97.6 Plus
Dyak\GE20443-PA 84 GE20443-PA 1..84 12..95 367 86.9 Plus
Dyak\GE21596-PA 86 GE21596-PA 1..86 12..95 206 51.2 Plus
Dyak\GE21594-PA 82 GE21594-PA 1..81 12..94 198 53 Plus
Dyak\GE21283-PA 82 GE21283-PA 1..82 12..95 192 52.4 Plus