IP16171.complete Sequence
428 bp assembled on 2020-02-20
GenBank Submission: BT033056
> IP16171.complete
CACCGCATTACCAACAAGAATCCTATACTAGCAACATGGTGTCGTTCGAG
GAAGCCACTGAACTCGCCAACAAGTTCACCAAGAAGCCCACGGATGCCGA
GTTCTTGGAATTCTACGGTCTCTTCAAGCAGGCCACCGTTGGCGATGTGA
ACATCGAGAAGCCCGGCGCTCTGGCTCTCAAGGACAAGGCCAAGTACGAG
GCCTGGAGCTCCAACAAGGGTCTCTCCAAGGAGGCTGCCAAGGAGGCCTA
CGTAAAGGTGTACGAGAAGTACGCCCCCAAGTACGCCTAAGCCGGCAACC
GATCAAATCCGATCCAATCCGATTCCGATTGCGGACCCCCCATGCACCTG
CCATCACCACTATAGTACTTAGTTGGACAATAAAGATTACCAGATATATG
AGCAATAAAAAAAAAAAAAAAAAAAAAA
IP16171.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:06:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8628-RA | 682 | CG8628-RA | 61..468 | 1..408 | 2040 | 100 | Plus |
CG8628-RB | 705 | CG8628-RB | 70..473 | 5..408 | 2020 | 100 | Plus |
CG8629-RA | 348 | CG8629-RA | 44..287 | 48..291 | 830 | 89.3 | Plus |
Blast to d_melanogaster_OreR.fa performed 2020-02-20 10:22:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 7123402..7123764 | 44..406 | 1800 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 7120242..7120485 | 291..48 | 815 | 88.9 | Minus |
chr3L | 24539361 | chr3L | 7123230..7123269 | 5..44 | 200 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:27:27 has no hits.
Blast to dmel-all-transcript-r6.23.fasta performed 2020-02-20 10:22:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acbp3-RA | 429 | CG8628-RA | 24..429 | 1..406 | 2030 | 100 | Plus |
Acbp3-RB | 408 | CG8628-RB | 7..408 | 5..406 | 2010 | 100 | Plus |
Acbp4-RA | 352 | CG8629-RA | 48..291 | 48..291 | 830 | 89.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2020-02-20 10:22:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7131143..7131507 | 44..408 | 1825 | 100 | Plus |
3L | 28110227 | 3L | 7127974..7128217 | 291..48 | 830 | 89.3 | Minus |
3L | 28110227 | 3L | 7130971..7131010 | 5..44 | 200 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:01:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 7124243..7124607 | 44..408 | 1825 | 100 | Plus |
3L | 28103327 | 3L | 7121074..7121317 | 291..48 | 830 | 89.3 | Minus |
3L | 28103327 | 3L | 7124071..7124110 | 5..44 | 200 | 100 | Plus |
Blast to na_custom.ecoli performed on 2008-06-09 15:39:11 has no hits.
Blast to na_te.dros performed on 2020-02-20 10:22:19 has no hits.
IP16171.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2020-02-20 10:22:25 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 7123228..7123269 | 1..44 | 95 | -> | Plus |
chr3L | 7123403..7123764 | 45..406 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:02:37 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RA | 1..255 | 36..290 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:07:30 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RA | 1..255 | 36..290 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:58 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RB | 1..255 | 36..290 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:17:35 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RA | 1..255 | 36..290 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:04:33 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RB | 1..255 | 36..290 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:36:28 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RA | 24..417 | 1..394 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:07:30 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RA | 24..429 | 1..406 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:58 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RA | 24..429 | 1..406 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:17:35 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RA | 24..417 | 1..394 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:04:33 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8628-RA | 24..429 | 1..406 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.23.fasta performed 2020-02-20 10:22:25 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acbp3-RA | 24..429 | 1..406 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2020-02-20 10:22:25 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7131144..7131505 | 45..406 | 100 | | Plus |
3L | 7130969..7131010 | 1..44 | 95 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2020-02-20 10:22:25 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7131144..7131505 | 45..406 | 100 | | Plus |
3L | 7130969..7131010 | 1..44 | 95 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:58 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7124069..7124110 | 1..44 | 95 | -> | Plus |
arm_3L | 7124244..7124605 | 45..406 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:40:40 Download gff for
IP16171.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7124069..7124110 | 1..44 | 95 | -> | Plus |
3L | 7124244..7124605 | 45..406 | 100 | | Plus |
IP16171.hyp Sequence
Translation from 0 to 289
> IP16171.hyp
QHYQQESYTSNMVSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVN
IEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYVKVYEKYAPKYA*
IP16171.hyp Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2020-02-20 10:24:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acbp3-PA | 84 | CG8628-PA | 1..84 | 12..95 | 430 | 100 | Plus |
Acbp3-PB | 84 | CG8628-PB | 1..84 | 12..95 | 430 | 100 | Plus |
Acbp4-PA | 84 | CG8629-PA | 1..84 | 12..95 | 366 | 83.3 | Plus |
Acbp6-PB | 82 | CG15829-PB | 1..81 | 12..94 | 219 | 53 | Plus |
Acbp6-PA | 82 | CG15829-PA | 1..81 | 12..94 | 219 | 53 | Plus |
Acbp2-PA | 86 | CG8627-PA | 6..86 | 15..95 | 213 | 51.9 | Plus |
Acbp2-PB | 86 | CG8627-PB | 6..86 | 15..95 | 213 | 51.9 | Plus |
Acbp5-PA | 82 | CG5804-PA | 1..81 | 12..94 | 205 | 51.8 | Plus |
Acbp1-PB | 90 | CG8498-PB | 2..76 | 10..84 | 182 | 46.7 | Plus |
Acbp1-PA | 90 | CG8498-PA | 2..76 | 10..84 | 182 | 46.7 | Plus |
anox-PB | 243 | CG33713-PB | 13..92 | 15..94 | 140 | 37.5 | Plus |
anox-PA | 243 | CG33713-PA | 13..92 | 15..94 | 140 | 37.5 | Plus |
IP16171.pep Sequence
Translation from 2 to 289
> IP16171.pep
PHYQQESYTSNMVSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVN
IEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYVKVYEKYAPKYA*
IP16171.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2020-02-20 10:22:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF25010-PA | 84 | GF25010-PA | 1..84 | 12..95 | 379 | 89.3 | Plus |
Dana\GF24791-PA | 84 | GF24791-PA | 1..84 | 12..95 | 367 | 86.9 | Plus |
Dana\GF25009-PA | 82 | GF25009-PA | 1..81 | 12..94 | 210 | 55.4 | Plus |
Dana\GF25011-PA | 85 | GF25011-PA | 5..85 | 15..95 | 203 | 53.1 | Plus |
Dana\GF10147-PA | 82 | GF10147-PA | 1..82 | 12..95 | 192 | 50 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2020-02-20 10:22:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14405-PA | 84 | GG14405-PA | 1..84 | 12..95 | 401 | 95.2 | Plus |
Dere\GG14997-PA | 84 | GG14997-PA | 1..84 | 12..95 | 367 | 86.9 | Plus |
Dere\GG14406-PA | 86 | GG14406-PA | 1..86 | 12..95 | 209 | 52.3 | Plus |
Dere\GG14404-PA | 82 | GG14404-PA | 1..81 | 12..94 | 200 | 51.8 | Plus |
Dere\GG15060-PA | 82 | GG15060-PA | 1..82 | 12..95 | 195 | 53.6 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2020-02-20 10:22:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH17042-PA | 84 | GH17042-PA | 1..84 | 12..95 | 363 | 84.5 | Plus |
Dgri\GH16140-PA | 84 | GH16140-PA | 1..84 | 12..95 | 284 | 65.5 | Plus |
Dgri\GH14516-PA | 82 | GH14516-PA | 1..81 | 12..94 | 212 | 54.2 | Plus |
Dgri\GH16139-PA | 81 | GH16139-PA | 1..80 | 13..94 | 207 | 51.2 | Plus |
Dgri\GH13894-PA | 81 | GH13894-PA | 1..80 | 13..94 | 207 | 51.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2020-02-20 10:22:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acbp3-PA | 84 | CG8628-PA | 1..84 | 12..95 | 430 | 100 | Plus |
Acbp3-PB | 84 | CG8628-PB | 1..84 | 12..95 | 430 | 100 | Plus |
Acbp4-PA | 84 | CG8629-PA | 1..84 | 12..95 | 366 | 83.3 | Plus |
Acbp6-PB | 82 | CG15829-PB | 1..81 | 12..94 | 219 | 53 | Plus |
Acbp6-PA | 82 | CG15829-PA | 1..81 | 12..94 | 219 | 53 | Plus |
Acbp2-PA | 86 | CG8627-PA | 6..86 | 15..95 | 213 | 51.9 | Plus |
Acbp2-PB | 86 | CG8627-PB | 6..86 | 15..95 | 213 | 51.9 | Plus |
Acbp5-PA | 82 | CG5804-PA | 1..81 | 12..94 | 205 | 51.8 | Plus |
Acbp1-PB | 90 | CG8498-PB | 2..76 | 10..84 | 182 | 46.7 | Plus |
Acbp1-PA | 90 | CG8498-PA | 2..76 | 10..84 | 182 | 46.7 | Plus |
anox-PB | 243 | CG33713-PB | 13..92 | 15..94 | 140 | 37.5 | Plus |
anox-PA | 243 | CG33713-PA | 13..92 | 15..94 | 140 | 37.5 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2020-02-20 10:22:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI13295-PA | 87 | GI13295-PA | 7..87 | 15..95 | 210 | 55.6 | Plus |
Dmoj\GI13294-PA | 82 | GI13294-PA | 1..81 | 12..94 | 185 | 51.8 | Plus |
Dmoj\GI17002-PA | 90 | GI17002-PA | 2..76 | 10..84 | 182 | 46.7 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2020-02-20 10:22:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25027-PA | 84 | GL25027-PA | 1..84 | 12..95 | 375 | 89.3 | Plus |
Dper\GL25142-PA | 84 | GL25142-PA | 1..84 | 12..95 | 355 | 82.1 | Plus |
Dper\GL25029-PA | 87 | GL25029-PA | 7..87 | 15..95 | 213 | 55.6 | Plus |
Dper\GL25026-PA | 82 | GL25026-PA | 1..78 | 12..91 | 194 | 52.5 | Plus |
Dper\GL19321-PA | 90 | GL19321-PA | 7..76 | 15..84 | 184 | 50 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2020-02-20 10:22:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA23591-PA | 84 | GA23591-PA | 1..84 | 12..95 | 375 | 89.3 | Plus |
Dpse\GA21220-PA | 84 | GA21220-PA | 1..84 | 12..95 | 355 | 82.1 | Plus |
Dpse\GA21218-PA | 87 | GA21218-PA | 7..87 | 15..95 | 213 | 55.6 | Plus |
Dpse\GA13977-PA | 82 | GA13977-PA | 1..78 | 12..91 | 194 | 52.5 | Plus |
Dpse\GA21120-PA | 90 | GA21120-PA | 7..76 | 15..84 | 183 | 50 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2020-02-20 10:22:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14821-PA | 84 | GM14821-PA | 1..84 | 12..95 | 413 | 98.8 | Plus |
Dsec\GM13788-PA | 84 | GM13788-PA | 1..84 | 12..95 | 356 | 83.3 | Plus |
Dsec\GM14822-PA | 86 | GM14822-PA | 1..86 | 12..95 | 208 | 52.3 | Plus |
Dsec\GM14820-PA | 82 | GM14820-PA | 1..81 | 12..94 | 207 | 54.2 | Plus |
Dsec\GM24916-PA | 81 | GM24916-PA | 13..81 | 25..95 | 184 | 56.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2020-02-20 10:22:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13994-PA | 84 | GD13994-PA | 1..84 | 12..95 | 413 | 98.8 | Plus |
Dsim\GD13089-PA | 84 | GD13089-PA | 1..84 | 12..95 | 356 | 83.3 | Plus |
Dsim\GD13995-PA | 86 | GD13995-PA | 1..86 | 12..95 | 211 | 53.5 | Plus |
Dsim\GD13993-PA | 82 | GD13993-PA | 1..81 | 12..94 | 207 | 54.2 | Plus |
Dsim\GD12963-PA | 82 | GD12963-PA | 1..82 | 12..95 | 190 | 51.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2020-02-20 10:22:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ13316-PA | 84 | GJ13316-PA | 1..84 | 12..95 | 350 | 81 | Plus |
Dvir\GJ12299-PA | 83 | GJ12299-PA | 1..83 | 13..95 | 267 | 65.1 | Plus |
Dvir\GJ12298-PA | 81 | GJ12298-PA | 1..80 | 13..94 | 209 | 51.2 | Plus |
Dvir\GJ12060-PA | 82 | GJ12060-PA | 1..81 | 12..94 | 207 | 54.2 | Plus |
Dvir\GJ12061-PA | 87 | GJ12061-PA | 7..87 | 15..95 | 201 | 53.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2020-02-20 10:22:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK17538-PA | 84 | GK17538-PA | 1..84 | 12..95 | 359 | 82.1 | Plus |
Dwil\GK19286-PA | 81 | GK19286-PA | 1..81 | 15..95 | 269 | 66.7 | Plus |
Dwil\GK16653-PA | 87 | GK16653-PA | 7..87 | 15..95 | 219 | 56.8 | Plus |
Dwil\GK19285-PA | 79 | GK19285-PA | 1..79 | 15..95 | 211 | 56.8 | Plus |
Dwil\GK23743-PA | 90 | GK23743-PA | 2..76 | 10..84 | 189 | 49.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2020-02-20 10:22:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21595-PA | 84 | GE21595-PA | 1..84 | 12..95 | 408 | 97.6 | Plus |
Dyak\GE20443-PA | 84 | GE20443-PA | 1..84 | 12..95 | 367 | 86.9 | Plus |
Dyak\GE21596-PA | 86 | GE21596-PA | 1..86 | 12..95 | 206 | 51.2 | Plus |
Dyak\GE21594-PA | 82 | GE21594-PA | 1..81 | 12..94 | 198 | 53 | Plus |
Dyak\GE21283-PA | 82 | GE21283-PA | 1..82 | 12..95 | 192 | 52.4 | Plus |