Clone IP16258 Report

Search the DGRC for IP16258

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:162
Well:58
Vector:pOT2
Associated Gene/TranscriptCG7276-RB
Protein status:IP16258.pep: gold
Sequenced Size:619

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7276 2008-04-29 Release 5.5 accounting
CG7276 2008-08-15 Release 5.9 accounting
CG7276 2008-12-18 5.12 accounting

Clone Sequence Records

IP16258.complete Sequence

619 bp (619 high quality bases) assembled on 2006-01-13

GenBank Submission: BT024239

> IP16258.complete
AACACAGATAAAAATATCGCAAAAATGTCGACACAAAGACCCAAAACCTT
GTCGACTGCAAAGGAGTCCTTTCGAGCGTCCGCGGTCAGCGCAGACAGCC
GATCCGAGGTAATGTCCCACAGTGACTCGGATGAAGAATGGGAGCCTGGG
AATGAGGATAAGCCGGCATCTGATGTCACCATCTATAACTACTACAACAT
GGGACCAGCATTCGGCAAGAAGTTCCCATTGCCGTACATTCGCTTGATGA
TAGCCCAGGTGGTCAAGGAGAAGCTGGCAAACAAGACCTATAATCAATCG
GAAGCCCTTAAATGGACCCGCGAAGTCGCCGATGACATAAACATTAAGAT
GAAGGGACGCGGCTCTTCTCCAAGATTCAAGCACGTTGTGAACGTAATGC
TTTACCAGCAGACCGGAGCCGGATGTTTCTACGGAGCTCGCGCCATTTGG
GATGAGCTGTCCGATGACTACATAACCTTCACCTTTGATGGTGGCAGTTT
TATCTGCATTGCTGCCGTTTTTGGTTGCTATCAGTACTAGGTTGATGTAC
AATTAATCAAATATAAGAAATTTTTTAGTATTATGCATTTGCATAAAATG
AAAAAAAAAAAAAAAAAAA

IP16258.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7276-RB 620 CG7276-RB 21..620 1..600 3000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15488180..15488774 6..600 2915 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:27:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15498222..15498823 1..602 3010 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15491322..15491923 1..602 3010 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:46:13 has no hits.

IP16258.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:46:57 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15488173..15488774 1..600 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:02:59 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 1..516 25..540 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:38:57 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 1..516 25..540 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:39:47 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 1..516 25..540 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:14:07 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 1..516 25..540 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:21 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 1..516 25..540 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:10:59 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 1..534 7..540 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:38:56 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 21..620 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:39:47 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 21..620 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:14:07 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 1..534 7..540 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:21 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
CG7276-RB 21..620 1..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:57 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15498222..15498821 1..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:57 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15498222..15498821 1..600 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:57 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15498222..15498821 1..600 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:39:47 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15491322..15491921 1..600 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:47 Download gff for IP16258.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15491322..15491921 1..600 100   Plus

IP16258.hyp Sequence

Translation from 0 to 539

> IP16258.hyp
NTDKNIAKMSTQRPKTLSTAKESFRASAVSADSRSEVMSHSDSDEEWEPG
NEDKPASDVTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQS
EALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIW
DELSDDYITFTFDGGSFICIAAVFGCYQY*

IP16258.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG7276-PB 171 CG7276-PB 1..171 9..179 906 100 Plus
CG5359-PC 173 CG5359-PC 3..173 3..179 293 39 Plus
CG5359-PB 173 CG5359-PB 3..173 3..179 293 39 Plus
CG5359-PA 173 CG5359-PA 3..173 3..179 293 39 Plus

IP16258.pep Sequence

Translation from 24 to 539

> IP16258.pep
MSTQRPKTLSTAKESFRASAVSADSRSEVMSHSDSDEEWEPGNEDKPASD
VTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTRE
VADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDELSDDYI
TFTFDGGSFICIAAVFGCYQY*

IP16258.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23698-PA 163 GF23698-PA 9..163 17..171 622 71 Plus
Dana\GF17142-PA 163 GF17142-PA 10..160 12..161 252 36.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15898-PA 171 GG15898-PA 1..171 1..171 833 86 Plus
Dere\GG17311-PA 173 GG17311-PA 48..173 43..171 295 43.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14539-PA 194 GH14539-PA 57..194 33..171 458 57.6 Plus
Dgri\GH13948-PA 194 GH13948-PA 57..194 33..171 458 57.6 Plus
Dgri\GH17964-PA 127 GH17964-PA 13..127 57..171 291 46.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7276-PB 171 CG7276-PB 1..171 1..171 906 100 Plus
CG5359-PC 173 CG5359-PC 10..173 2..171 285 39.4 Plus
CG5359-PB 173 CG5359-PB 10..173 2..171 285 39.4 Plus
CG5359-PA 173 CG5359-PA 10..173 2..171 285 39.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13110-PA 187 GI13110-PA 12..187 2..171 481 54.5 Plus
Dmoj\GI22085-PA 170 GI22085-PA 6..170 7..171 279 37.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:28:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20985-PA 181 GL20985-PA 1..181 1..171 545 56.9 Plus
Dper\GL27286-PA 170 GL27286-PA 56..170 57..171 285 45.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23483-PA 181 GA23483-PA 37..181 23..171 542 62.4 Plus
Dpse\GA18824-PA 170 GA18824-PA 56..170 57..171 285 45.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25527-PA 171 GM25527-PA 1..171 1..171 914 97.7 Plus
Dsec\GM26198-PA 170 GM26198-PA 10..170 12..171 312 42.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14543-PA 521 GD14543-PA 1..149 1..149 789 97.3 Plus
Dsim\GD20745-PA 173 GD20745-PA 10..173 12..171 311 41.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:28:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13857-PA 196 GJ13857-PA 55..196 27..171 472 60.7 Plus
Dvir\GJ22903-PA 92 GJ22903-PA 3..92 82..171 205 43.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20480-PA 253 GK20480-PA 129..253 47..171 492 64.8 Plus
Dwil\GK11896-PA 160 GK11896-PA 12..160 28..171 269 36.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23142-PA 171 GE23142-PA 1..171 1..171 831 87.1 Plus
Dyak\GE22239-PA 171 GE22239-PA 1..171 1..171 831 87.1 Plus
Dyak\GE24714-PA 173 GE24714-PA 48..173 43..171 287 42.6 Plus