![]() | BDGP Sequence Production Resources |
Search the DGRC for IP16258
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 162 |
Well: | 58 |
Vector: | pOT2 |
Associated Gene/Transcript | CG7276-RB |
Protein status: | IP16258.pep: gold |
Sequenced Size: | 619 |
Gene | Date | Evidence |
---|---|---|
CG7276 | 2008-04-29 | Release 5.5 accounting |
CG7276 | 2008-08-15 | Release 5.9 accounting |
CG7276 | 2008-12-18 | 5.12 accounting |
619 bp (619 high quality bases) assembled on 2006-01-13
GenBank Submission: BT024239
> IP16258.complete AACACAGATAAAAATATCGCAAAAATGTCGACACAAAGACCCAAAACCTT GTCGACTGCAAAGGAGTCCTTTCGAGCGTCCGCGGTCAGCGCAGACAGCC GATCCGAGGTAATGTCCCACAGTGACTCGGATGAAGAATGGGAGCCTGGG AATGAGGATAAGCCGGCATCTGATGTCACCATCTATAACTACTACAACAT GGGACCAGCATTCGGCAAGAAGTTCCCATTGCCGTACATTCGCTTGATGA TAGCCCAGGTGGTCAAGGAGAAGCTGGCAAACAAGACCTATAATCAATCG GAAGCCCTTAAATGGACCCGCGAAGTCGCCGATGACATAAACATTAAGAT GAAGGGACGCGGCTCTTCTCCAAGATTCAAGCACGTTGTGAACGTAATGC TTTACCAGCAGACCGGAGCCGGATGTTTCTACGGAGCTCGCGCCATTTGG GATGAGCTGTCCGATGACTACATAACCTTCACCTTTGATGGTGGCAGTTT TATCTGCATTGCTGCCGTTTTTGGTTGCTATCAGTACTAGGTTGATGTAC AATTAATCAAATATAAGAAATTTTTTAGTATTATGCATTTGCATAAAATG AAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7276-RB | 620 | CG7276-RB | 21..620 | 1..600 | 3000 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15488180..15488774 | 6..600 | 2915 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 15498222..15498823 | 1..602 | 3010 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 15491322..15491923 | 1..602 | 3010 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15488173..15488774 | 1..600 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 1..516 | 25..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 1..516 | 25..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 1..516 | 25..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 1..516 | 25..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 1..516 | 25..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 1..534 | 7..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 21..620 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 21..620 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 1..534 | 7..540 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7276-RB | 21..620 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15498222..15498821 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15498222..15498821 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15498222..15498821 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15491322..15491921 | 1..600 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15491322..15491921 | 1..600 | 100 | Plus |
Translation from 0 to 539
> IP16258.hyp NTDKNIAKMSTQRPKTLSTAKESFRASAVSADSRSEVMSHSDSDEEWEPG NEDKPASDVTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQS EALKWTREVADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIW DELSDDYITFTFDGGSFICIAAVFGCYQY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7276-PB | 171 | CG7276-PB | 1..171 | 9..179 | 906 | 100 | Plus |
CG5359-PC | 173 | CG5359-PC | 3..173 | 3..179 | 293 | 39 | Plus |
CG5359-PB | 173 | CG5359-PB | 3..173 | 3..179 | 293 | 39 | Plus |
CG5359-PA | 173 | CG5359-PA | 3..173 | 3..179 | 293 | 39 | Plus |
Translation from 24 to 539
> IP16258.pep MSTQRPKTLSTAKESFRASAVSADSRSEVMSHSDSDEEWEPGNEDKPASD VTIYNYYNMGPAFGKKFPLPYIRLMIAQVVKEKLANKTYNQSEALKWTRE VADDINIKMKGRGSSPRFKHVVNVMLYQQTGAGCFYGARAIWDELSDDYI TFTFDGGSFICIAAVFGCYQY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23698-PA | 163 | GF23698-PA | 9..163 | 17..171 | 622 | 71 | Plus |
Dana\GF17142-PA | 163 | GF17142-PA | 10..160 | 12..161 | 252 | 36.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15898-PA | 171 | GG15898-PA | 1..171 | 1..171 | 833 | 86 | Plus |
Dere\GG17311-PA | 173 | GG17311-PA | 48..173 | 43..171 | 295 | 43.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14539-PA | 194 | GH14539-PA | 57..194 | 33..171 | 458 | 57.6 | Plus |
Dgri\GH13948-PA | 194 | GH13948-PA | 57..194 | 33..171 | 458 | 57.6 | Plus |
Dgri\GH17964-PA | 127 | GH17964-PA | 13..127 | 57..171 | 291 | 46.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7276-PB | 171 | CG7276-PB | 1..171 | 1..171 | 906 | 100 | Plus |
CG5359-PC | 173 | CG5359-PC | 10..173 | 2..171 | 285 | 39.4 | Plus |
CG5359-PB | 173 | CG5359-PB | 10..173 | 2..171 | 285 | 39.4 | Plus |
CG5359-PA | 173 | CG5359-PA | 10..173 | 2..171 | 285 | 39.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13110-PA | 187 | GI13110-PA | 12..187 | 2..171 | 481 | 54.5 | Plus |
Dmoj\GI22085-PA | 170 | GI22085-PA | 6..170 | 7..171 | 279 | 37.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20985-PA | 181 | GL20985-PA | 1..181 | 1..171 | 545 | 56.9 | Plus |
Dper\GL27286-PA | 170 | GL27286-PA | 56..170 | 57..171 | 285 | 45.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23483-PA | 181 | GA23483-PA | 37..181 | 23..171 | 542 | 62.4 | Plus |
Dpse\GA18824-PA | 170 | GA18824-PA | 56..170 | 57..171 | 285 | 45.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25527-PA | 171 | GM25527-PA | 1..171 | 1..171 | 914 | 97.7 | Plus |
Dsec\GM26198-PA | 170 | GM26198-PA | 10..170 | 12..171 | 312 | 42.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14543-PA | 521 | GD14543-PA | 1..149 | 1..149 | 789 | 97.3 | Plus |
Dsim\GD20745-PA | 173 | GD20745-PA | 10..173 | 12..171 | 311 | 41.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13857-PA | 196 | GJ13857-PA | 55..196 | 27..171 | 472 | 60.7 | Plus |
Dvir\GJ22903-PA | 92 | GJ22903-PA | 3..92 | 82..171 | 205 | 43.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20480-PA | 253 | GK20480-PA | 129..253 | 47..171 | 492 | 64.8 | Plus |
Dwil\GK11896-PA | 160 | GK11896-PA | 12..160 | 28..171 | 269 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23142-PA | 171 | GE23142-PA | 1..171 | 1..171 | 831 | 87.1 | Plus |
Dyak\GE22239-PA | 171 | GE22239-PA | 1..171 | 1..171 | 831 | 87.1 | Plus |
Dyak\GE24714-PA | 173 | GE24714-PA | 48..173 | 43..171 | 287 | 42.6 | Plus |