Clone IP16275 Report

Search the DGRC for IP16275

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:162
Well:75
Vector:pOT2
Associated Gene/Transcriptobst-H-RA
Protein status:IP16275.pep: gold
Sequenced Size:933

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
obst-H 2008-04-29 Release 5.5 accounting
obst-H 2008-08-15 Release 5.9 accounting
obst-H 2008-12-18 5.12 accounting

Clone Sequence Records

IP16275.complete Sequence

933 bp (933 high quality bases) assembled on 2006-02-24

GenBank Submission: BT024933

> IP16275.complete
CGGAGCCAATAAAATGTCCAAATATCTGATACACCTGTGCCTGGTGCTGC
TCTGGAGCTCTCGGATAAATGCAGATCACTTTGACGAATGTGACGGGATG
GACGATGGGGCATTTGTACAAAGTTGGGAGAGCTGCCAATCCTACGTGTA
CTGCGAGGGTGAGGAATCCCTAAAGGGCGATTGCGAGGATGGTGAATACT
TTGATTCCGAGGCGGGAACCTGTGATATTGCGGCCAATGTGTCATGTTTC
CTGGACGAAGTCGATGAACCCTCGGACCCGGAACCGGAAACAGACGAAGA
AGAGGAGGAAATACCCGCGACACCAAGACCAACCGAACCACCGATTGTGG
AGACCCCAACCGAAGTGGATATCATAAATATTGCGCCCGTTGTAAGGCCC
AACTGTCCGATCAGCGATGATCCCGGCCAGGTTATATTCATGGCCAGCAA
TAATTCATGCACCAACTATTATCTCTGCTATCACGGCCATGCCATGGAAA
TGCACTGTGATAATGAGCTGTACTTTAATTCCCTCACCGGACAGTGCGAT
TACCCAGATAAAGTTCAGTGTGCCTTCGAAGATCCGCGATCCCACAAGTG
CCTGCCACACATGACCGAGTTCTTTCCACATCCGGACAACTGCAATTACT
TCTACTACTGCATCAAGGGCTTTCTGACCCTGCAACAGTGCCCCTTCTAC
TACGGCTGGGACATAGAACGCCGGAGTTGTGTGCAGATAGGTGTGGCGAA
ATGCTATGGAAACTCCAGAAGAATAGGTCGGAAAGCCCCATTGCCACCCA
GAAAACAACTCATCAAGTCTTAAGGGGAGTTGTCTACTAGATAAGAGCTC
TATTTATTGACAAGTTACAAGATTGTGGCGACATGAGACCTTTAATTAAA
TATAACTTATTAAAGAAAAAAAAAAAAAAAAAA

IP16275.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
obst-H-RA 987 obst-H-RA 73..987 1..915 4575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15518610..15519183 574..1 2795 99.1 Minus
chr3L 24539361 chr3L 15518205..15518545 915..575 1690 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:27:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15528670..15529243 574..1 2870 100 Minus
3L 28110227 3L 15528263..15528605 917..575 1715 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15521770..15522343 574..1 2870 100 Minus
3L 28103327 3L 15521363..15521705 917..575 1715 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:53:04 has no hits.

IP16275.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:54:16 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15518205..15518545 575..915 99 <- Minus
chr3L 15518610..15519183 1..574 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:01 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..810 14..823 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:56 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..810 14..823 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:01:56 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..810 14..823 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:24 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..810 14..823 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:34:23 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..810 14..823 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:30 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..810 14..823 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:56 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..915 1..915 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:01:56 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..915 1..915 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:24 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..810 14..823 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:23 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
obst-H-RA 1..915 1..915 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:16 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15528265..15528605 575..915 100 <- Minus
3L 15528670..15529243 1..574 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:16 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15528265..15528605 575..915 100 <- Minus
3L 15528670..15529243 1..574 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:54:16 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15528265..15528605 575..915 100 <- Minus
3L 15528670..15529243 1..574 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:01:56 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15521365..15521705 575..915 100 <- Minus
arm_3L 15521770..15522343 1..574 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:56 Download gff for IP16275.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15521365..15521705 575..915 100 <- Minus
3L 15521770..15522343 1..574 100   Minus

IP16275.hyp Sequence

Translation from 0 to 822

> IP16275.hyp
GANKMSKYLIHLCLVLLWSSRINADHFDECDGMDDGAFVQSWESCQSYVY
CEGEESLKGDCEDGEYFDSEAGTCDIAANVSCFLDEVDEPSDPEPETDEE
EEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASN
NSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPRSHKC
LPHMTEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSCVQIGVAK
CYGNSRRIGRKAPLPPRKQLIKS*

IP16275.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
obst-H-PA 269 CG33983-PA 1..269 5..273 1524 100 Plus
CG33985-PA 277 CG33985-PA 14..267 16..252 519 37.6 Plus
CG33986-PB 277 CG33986-PB 38..266 20..251 302 28.2 Plus
Muc68D-PB 1514 CG6004-PB 1313..1512 29..250 202 25.2 Plus
CG33263-PA 227 CG33263-PA 4..222 7..190 178 25.1 Plus
Muc68D-PB 1514 CG6004-PB 1266..1432 90..243 155 26.3 Plus

IP16275.pep Sequence

Translation from 13 to 822

> IP16275.pep
MSKYLIHLCLVLLWSSRINADHFDECDGMDDGAFVQSWESCQSYVYCEGE
ESLKGDCEDGEYFDSEAGTCDIAANVSCFLDEVDEPSDPEPETDEEEEEI
PATPRPTEPPIVETPTEVDIINIAPVVRPNCPISDDPGQVIFMASNNSCT
NYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPRSHKCLPHM
TEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSCVQIGVAKCYGN
SRRIGRKAPLPPRKQLIKS*

IP16275.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24464-PA 259 GF24464-PA 1..258 1..253 1004 74.5 Plus
Dana\GF24469-PA 290 GF24469-PA 1..286 1..253 472 35.9 Plus
Dana\GF24468-PA 266 GF24468-PA 38..255 32..247 277 28.7 Plus
Dana\GF19890-PA 232 GF19890-PA 6..224 3..257 222 25.4 Plus
Dana\GF10954-PA 192 GF10954-PA 9..191 8..249 180 26.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13539-PA 273 GG13539-PA 1..273 1..269 1198 84.6 Plus
Dere\GG13541-PA 274 GG13541-PA 8..264 6..248 471 38.8 Plus
Dere\GG13542-PA 290 GG13542-PA 60..279 32..247 269 28.7 Plus
Dere\GG11181-PA 221 GG11181-PA 12..221 10..266 205 28.5 Plus
Dere\GG13891-PA 1010 GG13891-PA 807..1008 25..246 155 22.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16813-PA 241 GH16813-PA 2..240 4..253 831 61.6 Plus
Dgri\GH16815-PA 281 GH16815-PA 20..270 11..248 421 36.4 Plus
Dgri\GH16816-PA 250 GH16816-PA 33..241 15..247 232 24.3 Plus
Dgri\GH19629-PA 192 GH19629-PA 21..190 16..248 183 23.2 Plus
Dgri\GH14678-PA 192 GH14678-PA 24..190 19..248 165 23 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
obst-H-PA 269 CG33983-PA 1..269 1..269 1524 100 Plus
CG33985-PA 277 CG33985-PA 14..267 12..248 519 37.6 Plus
CG33986-PB 277 CG33986-PB 38..266 16..247 302 28.2 Plus
CG13837-PA 223 CG13837-PA 9..214 8..256 231 27.6 Plus
Muc68D-PB 1514 CG6004-PB 1313..1512 25..246 202 25.2 Plus
CG33263-PA 227 CG33263-PA 4..222 3..186 178 25.1 Plus
CG4835-PB 1224 CG4835-PB 485..698 26..230 174 25.8 Plus
Cht10-PA 2286 CG18140-PA 695..941 32..265 166 23 Plus
Cht10-PC 2286 CG18140-PC 695..941 32..265 166 23 Plus
Cht10-PB 2286 CG18140-PB 695..941 32..265 166 23 Plus
obst-G-PA 279 CG9781-PA 32..273 26..264 165 23.6 Plus
CG10725-PB 269 CG10725-PB 1..261 1..239 164 23.8 Plus
CG10154-PB 316 CG10154-PB 143..306 40..235 157 23.6 Plus
CG10154-PA 316 CG10154-PA 143..306 40..235 157 23.6 Plus
CG7248-PA 796 CG7248-PA 44..228 2..216 156 26.6 Plus
Muc68D-PB 1514 CG6004-PB 1266..1432 86..239 155 26.3 Plus
CG7252-PA 474 CG7252-PA 30..314 26..250 151 24 Plus
CG10725-PB 269 CG10725-PB 94..212 146..263 150 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12216-PA 257 GI12216-PA 12..256 5..253 768 63.6 Plus
Dmoj\GI12219-PA 271 GI12219-PA 18..270 21..254 412 33.8 Plus
Dmoj\GI12221-PA 269 GI12221-PA 35..260 15..247 262 26.4 Plus
Dmoj\GI13576-PA 286 GI13576-PA 6..276 3..257 159 23.6 Plus
Dmoj\GI11514-PA 274 GI11514-PA 6..266 1..239 155 23.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25551-PA 260 GL25551-PA 1..259 1..253 982 74.1 Plus
Dper\GL25573-PA 271 GL25573-PA 1..269 1..252 506 40.1 Plus
Dper\GL25584-PA 267 GL25584-PA 33..254 32..247 279 30.8 Plus
Dper\GL27122-PA 239 GL27122-PA 10..233 6..262 258 29.8 Plus
Dper\GL25445-PA 268 GL25445-PA 26..260 26..239 156 22.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20733-PA 258 GA20733-PA 1..257 1..253 984 75.5 Plus
Dpse\GA23637-PA 271 GA23637-PA 1..270 1..254 506 40.1 Plus
Dpse\GA23638-PA 267 GA23638-PA 33..254 32..247 280 30.8 Plus
Dpse\GA12560-PA 240 GA12560-PA 10..234 6..262 241 28.9 Plus
Dpse\GA28616-PA 196 GA28616-PA 22..191 19..250 187 24.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24482-PA 269 GM24482-PA 1..269 1..269 1412 97.4 Plus
Dsec\GM24484-PA 276 GM24484-PA 14..266 12..248 469 37.9 Plus
Dsec\GM24485-PA 274 GM24485-PA 38..263 16..247 284 29.4 Plus
Dsec\GM26480-PA 226 GM26480-PA 12..215 10..256 230 28.2 Plus
Dsec\GM24595-PA 227 GM24595-PA 1..223 1..248 201 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17570-PA 127 GD17570-PA 1..127 143..269 688 97.6 Plus
Dsim\GD12556-PA 276 GD12556-PA 10..266 8..248 469 37.6 Plus
Dsim\GD12557-PA 279 GD12557-PA 39..268 15..247 272 28.5 Plus
Dsim\GD15179-PA 225 GD15179-PA 6..214 5..256 230 27.6 Plus
Dsim\GD12664-PA 226 GD12664-PA 1..223 1..248 210 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11448-PA 252 GJ11448-PA 1..251 1..253 837 62.1 Plus
Dvir\GJ11450-PA 271 GJ11450-PA 22..269 20..252 459 35.9 Plus
Dvir\GJ11451-PA 268 GJ11451-PA 34..259 15..247 276 27.2 Plus
Dvir\GJ11255-PA 1782 GJ11255-PA 1567..1780 25..247 168 21.4 Plus
Dvir\GJ13591-PA 180 GJ13591-PA 38..178 141..248 147 26.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10516-PA 272 GK10516-PA 1..271 1..253 883 62 Plus
Dwil\GK10521-PA 276 GK10521-PA 23..276 21..254 452 34.6 Plus
Dwil\GK10520-PA 286 GK10520-PA 40..276 15..250 276 28.6 Plus
Dwil\GK19192-PA 240 GK19192-PA 25..225 16..248 261 27.8 Plus
Dwil\GK17084-PA 260 GK17084-PA 1..252 8..239 162 22.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22838-PA 271 GE22838-PA 1..271 1..269 1189 89.3 Plus
Dyak\GE19840-PA 271 GE19840-PA 1..271 1..269 1189 89.3 Plus
Dyak\GE19842-PA 274 GE19842-PA 8..264 6..248 492 38.8 Plus
Dyak\GE22841-PA 274 GE22841-PA 8..264 6..248 491 38.8 Plus
Dyak\GE19843-PA 277 GE19843-PA 38..266 16..247 272 28.6 Plus