Clone IP16368 Report

Search the DGRC for IP16368

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:163
Well:68
Vector:pOT2
Associated Gene/TranscriptMgstl-RA
Protein status:IP16368.pep: gold
Sequenced Size:664

Clone Sequence Records

IP16368.complete Sequence

664 bp assembled on 2010-01-15

GenBank Submission: BT120131.1

> IP16368.complete
GCCGAGCAAGTTGTTGAATCCCAGACCAGACATTTTACGTACTATAAAGA
TAATAAAGTTATAGTTAAAACACATACAATGGCCAGCCCCGTGGAACTGC
TAAGCCTCTCCAATCCCGTCTTCAAGAGTTTCACCTTTTGGGTCGGAGTT
TTGGTGATCAAAATGCTGCTGATGAGCCTTCTGACAGCCATCCAGCGTTT
CAAGACGAAGACCTTCGCCAACCCCGAGGACCTGATGTCCCCCAAGCTGA
AGGTCAAGTTCGACGATCCGAACGTGGAGCGTGTGCGCCGTGCCCACCGC
AACGACCTGGAGAACATCCTGCCCTTCTTCGCCATCGGTCTGCTCTACGT
CCTGACTGATCCGGCCGCCTTTCTGGCCATCAACCTGTTCCGCGCCGTGG
GCATCGCCCGCATCGTCCACACACTGGTCTACGCCGTGGTCGTGGTGCCC
CAGCCTTCCCGTGCCCTCGCCTTCTTCGTGGCCTTGGGCGCCACCGTCTA
CATGGCCCTGCAGGTCATCGCCTCGGCCGCCTTCTGAGCACATAGGTCTA
GTCCTTCTTGTTTTTTTTTTTAAGCATTTTGAAATAATTTCTGAAATATA
GAGTTACGCCTACCTCGGCTTTGGTGCTGTTGGATCACAAAAAAAAAAAA
AAAAAAAAAAAAAA

IP16368.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-RA 711 Mgstl-RA 34..673 1..640 3200 100 Plus
Mgstl.a 1218 Mgstl.a 34..673 1..640 3200 100 Plus
Mgstl.b 894 Mgstl.b 34..673 1..640 3200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22224686..22225302 21..638 2710 96.3 Plus
chrX 22417052 chrX 20908835..20909264 209..638 2150 100 Plus
chrX 22417052 chrX 20908249..20908458 1..210 1050 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:27:51
Subject Length Description Subject Range Query Range Score Percent Strand
CR12628-RA 621 CR12628-RA 5..621 21..638 2720 96.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22226155..22226782 21..649 2765 96.3 Plus
X 23542271 X 21043678..21044109 209..640 2160 100 Plus
X 23542271 X 21043092..21043301 1..210 1050 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22226155..22226782 21..649 2775 96.3 Plus
X 23527363 X 21028770..21029201 209..640 2160 100 Plus
X 23527363 X 21028184..21028393 1..210 1050 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:09:11 has no hits.

IP16368.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:10:10 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22224682..22225295 16..631 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-15 11:20:22 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 79..537 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:40 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 79..537 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:04:49 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 79..537 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:29:01 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 1..459 79..537 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 18:27:52 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
CR12628-RA 1..621 16..638 96   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-15 11:20:22 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 21..658 1..638 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:40 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 21..658 1..638 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:04:49 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 23..660 1..638 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:29:01 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RA 23..660 1..638 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:10 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226151..22226771 16..638 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:10 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226151..22226771 16..638 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:10:10 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226151..22226771 16..638 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:04:49 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22226151..22226771 16..638 96   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:52 Download gff for IP16368.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22226151..22226771 16..638 96   Plus

IP16368.pep Sequence

Translation from 0 to 536

> IP16368.pep
AEQVVESQTRHFTYYKDNKVIVKTHTMASPVELLSLSNPVFKSFTFWVGV
LVIKMLLMSLLTAIQRFKTKTFANPEDLMSPKLKVKFDDPNVERVRRAHR
NDLENILPFFAIGLLYVLTDPAAFLAINLFRAVGIARIVHTLVYAVVVVP
QPSRALAFFVALGATVYMALQVIASAAF*

IP16368.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21709-PA 195 GF21709-PA 43..195 26..178 744 92.8 Plus
Dana\GF21219-PA 170 GF21219-PA 16..159 26..169 434 59.7 Plus
Dana\GF21218-PA 170 GF21218-PA 6..159 17..169 430 56.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19704-PA 195 GG19704-PA 44..195 27..178 770 98.7 Plus
Dere\GG17862-PA 165 GG17862-PA 9..154 24..169 462 60.3 Plus
Dere\GG17861-PA 167 GG17861-PA 19..163 33..176 410 56.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12207-PA 191 GH12207-PA 44..191 31..178 680 87.8 Plus
Dgri\GH24641-PA 162 GH24641-PA 1..151 31..169 449 59.6 Plus
Dgri\GH24640-PA 167 GH24640-PA 2..160 17..173 403 53.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-PA 152 CG1742-PA 1..152 27..178 749 100 Plus
Mgstl-PC 151 CG1742-PC 5..151 32..178 614 83 Plus
Mgstl-PB 151 CG1742-PB 5..151 32..178 614 83 Plus
CG33178-PC 165 CG33178-PC 12..157 27..172 446 61 Plus
CG33178-PA 165 CG33178-PA 12..157 27..172 446 61 Plus
CG33178-PB 177 CG33178-PB 12..169 27..172 423 56.3 Plus
CG33177-PA 167 CG33177-PA 2..160 17..173 403 55.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15739-PA 150 GI15739-PA 3..150 31..178 693 89.2 Plus
Dmoj\GI21688-PA 177 GI21688-PA 10..166 25..169 447 57.3 Plus
Dmoj\GI21687-PA 159 GI21687-PA 1..155 22..176 390 51.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16397-PA 195 GL16397-PA 44..195 27..178 707 88.8 Plus
Dper\GL15178-PA 163 GL15178-PA 6..152 23..169 461 60.5 Plus
Dper\GL15177-PA 166 GL15177-PA 2..162 17..176 414 53.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14506-PA 195 GA14506-PA 44..195 27..178 707 88.8 Plus
Dpse\GA22801-PA 163 GA22801-PA 6..152 23..169 461 60.5 Plus
Dpse\GA22800-PA 166 GA22800-PA 2..162 17..176 415 53.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23058-PA 195 GM23058-PA 44..195 27..178 777 100 Plus
Dsec\GM12056-PA 165 GM12056-PA 8..154 23..169 462 59.9 Plus
Dsec\GM12055-PA 167 GM12055-PA 19..163 33..176 413 57.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17510-PA 195 GD17510-PA 44..195 27..178 771 98.7 Plus
Dsim\GD17192-PA 165 GD17192-PA 8..154 23..169 462 59.9 Plus
Dsim\GD17191-PA 167 GD17191-PA 19..163 33..176 413 57.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18600-PA 191 GJ18600-PA 51..191 38..178 660 90.1 Plus
Dvir\GJ15869-PA 162 GJ15869-PA 1..151 31..169 440 58.9 Plus
Dvir\GJ15868-PA 165 GJ15868-PA 2..161 17..176 421 54 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25033-PA 152 GK25033-PA 1..152 27..178 648 80.9 Plus
Dwil\GK16260-PA 185 GK16260-PA 28..174 35..169 424 57.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17903-PA 195 GE17903-PA 44..195 27..178 682 92.8 Plus
Dyak\GE17164-PA 165 GE17164-PA 8..154 23..169 461 59.9 Plus
Dyak\GE17163-PA 167 GE17163-PA 2..163 17..176 413 53.1 Plus

IP16368.hyp Sequence

Translation from 162 to 536

> IP16368.hyp
MLLMSLLTAIQRFKTKTFANPKDLMSPKLKVKFDDPNVERVRRAHRNDLE
NILPFFAIGLLYVLTDPAAFLAINLYRAVGIAHIVHTLVDAVVVVPQPSR
ALAFFVALGATVYMALQVIASAAF*

IP16368.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-PA 152 CG1742-PA 29..152 1..124 587 96.8 Plus
Mgstl-PC 151 CG1742-PC 33..151 6..124 533 90.8 Plus
Mgstl-PB 151 CG1742-PB 33..151 6..124 533 90.8 Plus
CG33178-PC 165 CG33178-PC 40..157 1..118 348 60.2 Plus
CG33178-PA 165 CG33178-PA 40..157 1..118 348 60.2 Plus