Clone IP16416 Report

Search the DGRC for IP16416

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:164
Well:16
Vector:pOT2
Associated Gene/TranscriptCG9410-RA
Protein status:IP16416.pep: gold
Sequenced Size:824

Clone Sequence Records

IP16416.complete Sequence

824 bp assembled on 2010-01-14

GenBank Submission: BT120128.1

> IP16416.complete
CCTACATACCTATTCCGCATCCGCATCCCAACGCTCCAGCTTTGCCTAAA
ATGCTAAAGGGTAGCACACTGAAAGCCCTGGACGTCAGAATCCTATGGCC
CCTTATTGAAACAAGTGGAGGACACCAGCGCAGCTTCTCCAGCAGCACCC
ACCGGTCCTACATAACATTCAATGATTTCCGCAAAAAACACCGCTGGTAC
ACAAAAAAGGAGCTTGTGGGCTACTCCATGCAGGACATGTACAGCGTGGT
TTCCGACGTCAGCAATTACCACAAGTTCGTGCCGTATGTGAAGCGCTCCG
ATGTGCACAGCCGGGGAAGTGAGGGCTTCAAGGCGGACCTCATTGTTGGC
TTTCCGCCGCTTAACGAGGCCTACACCTCGCAGGTGACCCTGGTGCCGCC
CAGCTTGGTTAAGTCAGAGTGCCACGATGGACGTCTGTTCAACTACCTCC
TGAATGAGTGGTCTTTTAAGCCGGGCCTCAAGGACATACCTAACTCCTGC
GTGCTGGACTTCAAGGTATCGTTCGAGTTCAAGTCCCTCCTGCACAGCAA
CGTCGCCAACATATTTTTTGACCTTATCTGCGATCAAATGGAAAACGCTT
TTATCCAGGAGGTCCGTCGACGGAGTGGTCCGCCCTCAATCCGCTCCCAC
GTGCTTACTTCGGATCGGTCCTGACCAGAAGAATTGTGGAGATGTTTTTT
CTTTAGTGATTTAAGTTAAAGTTGTGTACATTGCGTTGTCAAACCTCTTA
GCTAGTACAATTAACCAAATTGTAAATAAATTGATTATCAGTTTGTGTAT
AAAAAAAAAAAAAAAAAAAAAAAA

IP16416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9410-RA 891 CG9410-RA 87..889 1..803 4015 100 Plus
CG9410-RD 1442 CG9410-RD 751..1440 114..803 3450 100 Plus
CG15908-RB 1442 CG15908-RB 751..1440 114..803 3450 100 Plus
CG9410-RD 1442 CG9410-RD 533..647 1..115 575 100 Plus
CG15908-RB 1442 CG15908-RB 533..647 1..115 575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2556683..2557263 220..800 2890 99.8 Plus
chr2R 21145070 chr2R 2556302..2556416 1..115 575 100 Plus
chr2R 21145070 chr2R 2556520..2556626 114..220 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:27:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6669491..6670074 220..803 2920 100 Plus
2R 25286936 2R 6669110..6669224 1..115 575 100 Plus
2R 25286936 2R 6669328..6669434 114..220 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6670690..6671273 220..803 2920 100 Plus
2R 25260384 2R 6670309..6670423 1..115 575 100 Plus
2R 25260384 2R 6670527..6670633 114..220 535 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:53:51 has no hits.

IP16416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:54:47 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2556522..2556626 116..220 100 -> Plus
chr2R 2556302..2556416 1..115 100 -> Plus
chr2R 2556684..2557263 221..800 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-01-14 18:33:38 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RA 1..624 51..674 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:52:36 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RA 1..624 51..674 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:34:56 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RA 1..624 51..674 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:57 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RA 1..624 51..674 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-14 18:33:36 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RA 87..886 1..800 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:52:36 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RA 87..886 1..800 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:34:56 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RA 87..886 1..800 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:57 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RA 87..886 1..800 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:47 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6669110..6669224 1..115 100 -> Plus
2R 6669330..6669434 116..220 100 -> Plus
2R 6669492..6670071 221..800 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:47 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6669110..6669224 1..115 100 -> Plus
2R 6669330..6669434 116..220 100 -> Plus
2R 6669492..6670071 221..800 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:54:47 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6669110..6669224 1..115 100 -> Plus
2R 6669330..6669434 116..220 100 -> Plus
2R 6669492..6670071 221..800 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:34:56 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2556615..2556729 1..115 100 -> Plus
arm_2R 2556835..2556939 116..220 100 -> Plus
arm_2R 2556997..2557576 221..800 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:28:48 Download gff for IP16416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6670691..6671270 221..800 100   Plus
2R 6670309..6670423 1..115 100 -> Plus
2R 6670529..6670633 116..220 100 -> Plus

IP16416.hyp Sequence

Translation from 2 to 673

> IP16416.hyp
YIPIPHPHPNAPALPKMLKGSTLKALDVRILWPLIETSGGHQRSFSSSTH
RSYITFNDFRKKHRWYTKKELVGYSMQDMYSVVSDVSNYHKFVPYVKRSD
VHSRGSEGFKADLIVGFPPLNEAYTSQVTLVPPSLVKSECHDGRLFNYLL
NEWSFKPGLKDIPNSCVLDFKVSFEFKSLLHSNVANIFFDLICDQMENAF
IQEVRRRSGPPSIRSHVLTSDRS*

IP16416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG9410-PA 207 CG9410-PA 1..207 17..223 1093 100 Plus
CG9410-PB 242 CG9410-PB 1..242 17..223 1047 85.5 Plus

IP16416.pep Sequence

Translation from 2 to 673

> IP16416.pep
YIPIPHPHPNAPALPKMLKGSTLKALDVRILWPLIETSGGHQRSFSSSTH
RSYITFNDFRKKHRWYTKKELVGYSMQDMYSVVSDVSNYHKFVPYVKRSD
VHSRGSEGFKADLIVGFPPLNEAYTSQVTLVPPSLVKSECHDGRLFNYLL
NEWSFKPGLKDIPNSCVLDFKVSFEFKSLLHSNVANIFFDLICDQMENAF
IQEVRRRSGPPSIRSHVLTSDRS*

IP16416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11062-PA 207 GF11062-PA 1..207 17..223 943 84.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23213-PA 207 GG23213-PA 1..207 17..223 1053 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21745-PA 217 GH21745-PA 1..216 17..222 844 76.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9410-PA 207 CG9410-PA 1..207 17..223 1093 100 Plus
CG9410-PB 242 CG9410-PB 1..242 17..223 1047 85.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19293-PA 211 GI19293-PA 1..211 17..223 839 77.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11110-PA 207 GL11110-PA 1..207 17..223 943 86 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21766-PA 207 GA21766-PA 1..207 17..223 943 86 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20887-PA 207 GM20887-PA 1..207 17..223 1074 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10417-PA 207 GD10417-PA 1..207 17..223 1074 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22169-PA 210 GJ22169-PA 1..210 17..223 880 80.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23085-PA 148 GK23085-PA 1..148 76..223 657 81.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19067-PA 207 GE19067-PA 1..207 17..223 1048 95.7 Plus