Clone IP16508 Report

Search the DGRC for IP16508

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:165
Well:8
Vector:pOT2
Associated Gene/TranscriptCG10799-RA
Protein status:IP16508.pep: gold
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10799-RA 2009-01-21 est gleaning

Clone Sequence Records

IP16508.complete Sequence

622 bp assembled on 2009-02-18

GenBank Submission: BT060436.1

> IP16508.complete
TCAGTCTCAGCGAGAAGAACCCACCCATCAAGCTAGTGGAATAGTGGAGT
TTACCAGGATATACAAAGATTACCGGGATGCGTCGATCTGTTTTGCTGTT
CCTAATCTCCGCCATTGTGCTGAGCGCGGCACTTCCTTTGCCCCCAATTT
GGGAGGACTCCGAATCGGATTCCGAGTATAATGATTATAGTGAGCTATCG
AAGCAGCAGAATCTGAAGAGCAGTATCGAGAAAACTATCAGCAAGCGAGC
TACCAAGGACACTAGTAACAGCACGGAAGATGATGAGCTCACGGATGGTA
GCAATGAGAATGTTAACGATAAAATGGACAGCTCAATGGAATCGTCTTCT
ATGCTGATCATGGCATCCGAGGAAGAATCGGAGTCCGCTGTCAGAAGGCG
CAGGTCTGGTGAGAGGAACAGGAATATAGGGCTCCTGGCCACGATTTGCC
CAAATGCTGATTTCAGAGATTTGGAGAACGGTATTACCCTAGATTCTAGA
ATTGAAATAAGGGATATGTATGCGATTTGTAAAACTCTACCAGAGTCCGG
TCGTCTACAGCAATACAACCGTTCATAAATTAAATAAAAGCAAAGAAGAA
TTCTAAAAAAAAAAAAAAAAAA

IP16508.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG10799-RA 607 CG10799-RA 1..597 13..609 2985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9145235..9145838 1..604 2975 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13257874..13258482 1..609 3045 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13259073..13259681 1..609 3045 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:54:41 has no hits.

IP16508.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:55:19 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9145235..9145838 1..604 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:48 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
CG10799-RA 1..501 78..578 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:35:02 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
CG10799-RA 1..501 78..578 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:45 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
CG10799-RA 1..501 78..578 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:25:42 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
CG10799-RA 1..501 78..578 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-18 09:38:06 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
CG10799-RA 1..592 13..604 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:35:02 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
CG10799-RA 1..592 13..604 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:45 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
CG10799-RA 1..592 13..604 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:25:42 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
CG10799-RA 1..592 13..604 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:19 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13257874..13258477 1..604 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:19 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13257874..13258477 1..604 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:55:19 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13257874..13258477 1..604 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:45 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9145379..9145982 1..604 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:23 Download gff for IP16508.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13259073..13259676 1..604 100   Plus

IP16508.pep Sequence

Translation from 77 to 577

> IP16508.pep
MRRSVLLFLISAIVLSAALPLPPIWEDSESDSEYNDYSELSKQQNLKSSI
EKTISKRATKDTSNSTEDDELTDGSNENVNDKMDSSMESSSMLIMASEEE
SESAVRRRRSGERNRNIGLLATICPNADFRDLENGITLDSRIEIRDMYAI
CKTLPESGRLQQYNRS*

IP16508.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG10799-PA 166 CG10799-PA 1..166 1..166 826 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21460-PA 167 GM21460-PA 1..160 1..161 550 75.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10958-PA 174 GD10958-PA 1..165 1..159 559 80 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12532-PA 132 GE12532-PA 1..126 1..155 329 53.5 Plus
Dyak\GE12534-PA 159 GE12534-PA 1..153 1..156 270 57.7 Plus

IP16508.hyp Sequence

Translation from 77 to 577

> IP16508.hyp
MRRSVLLFLISAIVLSAALPLPPIWEDSESDSEYNDYSELSKQQNLKSSI
EKTISKRATKDTSNSTEDDELTDGSNENVNDKMDSSMESSSMLIMASEEE
SESAVRRRRSGERNRNIGLLATICPNADFRDLENGITLDSRIEIRDMYAI
CKTLPESGRLQQYNRS*

IP16508.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG10799-PA 166 CG10799-PA 1..166 1..166 826 100 Plus