Clone IP16516 Report

Search the DGRC for IP16516

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:165
Well:16
Vector:pOT2
Associated Gene/TranscriptCG9410-RB
Protein status:IP16516.pep: gold
Sequenced Size:1422

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9410 2008-04-29 Release 5.5 accounting
CG15908 2008-08-15 Release 5.9 accounting
CG9410 2008-08-15 Release 5.9 accounting
CG9410 2008-12-18 5.12 accounting
CG15908 2008-12-18 5.12 accounting

Clone Sequence Records

IP16516.complete Sequence

1422 bp (1422 high quality bases) assembled on 2005-11-21

GenBank Submission: BT024240

> IP16516.complete
AAATGGCCACAAAATCGGATAATGCTGACTCAAAATCGGACAAATCAAAG
GAATCACTAGATGACGCATGGGCAATCCGACCCTGTCATCTGTACAAGGA
GGAGTACGACGACTGCACGAGTTTTAAGGCGCGCTTCCACCAGTACTTTA
TATTTGGCAAGGACACAGATTGCTCCCAATGGCTAACTGATTACCGTAAC
TGCGAACGATATCAGCAGTCCAACGGGAACGATGTGGCTGCCGGCAAAGC
GGTGATTAAAAGCGAGGAGGAGCGCCGAAGGATCCGCCTGCGCGCCCACT
TTGCCAACGACACTTGGCAGAAGCGTAAGAAGCCACCGCTGGATTGGGCT
GCTCCTCTGCCGGACTGGATGGAGAAGCGAAACGAGAATACCTATCTTGA
GCTTAAGCAAAAAGAGCTCTCTGGACAGGCGGCGCCGCAAGGAGAGGAAC
GCTCGCTGTGCACGATCATGTGAAGATAAATAATACGGGCTGATATCTAC
CTACATACCTATTCCGCATCCGCATCCCAACGCTCCAGCTTTGCCTAAAA
TGCTAAAGGGTAGCACACTGAAAGCCCTGGACGTCAGAATCCTATGGCCC
CTTATTGAAACAAGGTCAGCAGGTAAATGTAAATTACATAACCCGAGGCC
GACTCCAAACCGTAACATTGCGGCAGCAAAATTGATCGTGACACTCAGAT
TGCTCTTATCCTGTTGCAGTGGAGGACACCAGCGCAGCTTCTCCAGCAGC
ACCCACCGGTCCTACATAACATTCAATGATTTCCGCAAAAAACACCGCTG
GTACACAAAAAAGGAGCTTGTGGGCTACTCCATGCAGGACATGTACAGCG
TGGTTTCCGACGTCAGCAATTACCACAAGTTCGTGCCGTATGTGAAGCGC
TCCGATGTGCACAGCCGGGGAAGTGAGGGCTTCAAGGCGGACCTCATTGT
TGGCTTTCCGCCGCTTAACGAGGCCTACACCTCGCAGGTGACCCTGGTGC
CGCCCAGCTTGGTTAAGTCAGAGTGCCACGATGGACGTCTGTTCAACTAC
CTCCTGAATGAGTGGTCTTTTAAGCCGGGCCTCAAGGACATACCTAACTC
CTGCGTGCTGGACTTCAAGGTATCGTTCGAGTTCAAGTCCCTCCTGCACA
GCAACGTCGCCAACATATTTTTTGACCTTATCTGCGATCAAATGGAAAAC
GCTTTTATCCAGGAGGTCCGTCGACGGAGTGGTCCGCCCTCAATCCGCTC
CCACGTGCTTACTTCGGATCGGTCCTGACCAGAAGAATTGTGGAGATGTT
TTTTCTTTAGTGATTTAAGTTAAAGTTGTGTACATTGCGTTGTCAAACCT
CTTAGCTAGTACAATTAACCAAATTGTAAATAAATTGATTATCAGTTTGT
GTATAAAAAAAAAAAAAAAAAA

IP16516.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG9410-RD 1442 CG9410-RD 34..1440 1..1407 7035 100 Plus
CG15908-RB 1442 CG15908-RB 34..1440 1..1407 7035 100 Plus
CG9410-RA 891 CG9410-RA 200..889 718..1407 3450 100 Plus
CG9410-RA 891 CG9410-RA 70..201 483..614 660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2556683..2557263 824..1404 2890 99.8 Plus
chr2R 21145070 chr2R 2555501..2555908 75..482 2040 100 Plus
chr2R 21145070 chr2R 2556285..2556626 483..824 1710 100 Plus
chr2R 21145070 chr2R 2555375..2555448 1..74 370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6669491..6670074 824..1407 2920 100 Plus
2R 25286936 2R 6668309..6668716 75..482 2040 100 Plus
2R 25286936 2R 6669093..6669434 483..824 1710 100 Plus
2R 25286936 2R 6668183..6668256 1..74 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6670690..6671273 824..1407 2920 100 Plus
2R 25260384 2R 6669508..6669915 75..482 2040 100 Plus
2R 25260384 2R 6670292..6670633 483..824 1710 100 Plus
2R 25260384 2R 6669382..6669455 1..74 370 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:24:21 has no hits.

IP16516.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:25:16 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2555375..2555448 1..74 100 -> Plus
chr2R 2555501..2555908 75..482 100 -> Plus
chr2R 2556285..2556626 483..824 100 -> Plus
chr2R 2556684..2557263 825..1404 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:33 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RD 1..729 550..1278 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:45:40 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RD 1..729 550..1278 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:25 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RB 1..729 550..1278 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:27:05 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RD 1..729 550..1278 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:26:35 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RB 1..729 550..1278 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:18:56 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RD 34..1437 1..1404 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:45:40 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RD 34..1437 1..1404 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:25 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RB 2..925 482..1404 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:27:06 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RD 34..1437 1..1404 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:26:35 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
CG9410-RB 2..925 482..1404 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:16 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6668183..6668256 1..74 100 -> Plus
2R 6668309..6668716 75..482 100 -> Plus
2R 6669093..6669434 483..824 100 -> Plus
2R 6669492..6670071 825..1404 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:16 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6668183..6668256 1..74 100 -> Plus
2R 6668309..6668716 75..482 100 -> Plus
2R 6669093..6669434 483..824 100 -> Plus
2R 6669492..6670071 825..1404 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:16 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6668183..6668256 1..74 100 -> Plus
2R 6668309..6668716 75..482 100 -> Plus
2R 6669093..6669434 483..824 100 -> Plus
2R 6669492..6670071 825..1404 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:25 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2556598..2556939 483..824 100 -> Plus
arm_2R 2555688..2555761 1..74 100 -> Plus
arm_2R 2555814..2556221 75..482 100 -> Plus
arm_2R 2556997..2557576 825..1404 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:06:20 Download gff for IP16516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6669508..6669915 75..482 100 -> Plus
2R 6670292..6670633 483..824 100 -> Plus
2R 6670691..6671270 825..1404 100   Plus
2R 6669382..6669455 1..74 100 -> Plus

IP16516.pep Sequence

Translation from 549 to 1277

> IP16516.pep
MLKGSTLKALDVRILWPLIETRSAGKCKLHNPRPTPNRNIAAAKLIVTLR
LLLSCCSGGHQRSFSSSTHRSYITFNDFRKKHRWYTKKELVGYSMQDMYS
VVSDVSNYHKFVPYVKRSDVHSRGSEGFKADLIVGFPPLNEAYTSQVTLV
PPSLVKSECHDGRLFNYLLNEWSFKPGLKDIPNSCVLDFKVSFEFKSLLH
SNVANIFFDLICDQMENAFIQEVRRRSGPPSIRSHVLTSDRS*

IP16516.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11062-PA 207 GF11062-PA 1..207 1..242 903 72.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23213-PA 207 GG23213-PA 1..207 1..242 1010 82.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21745-PA 217 GH21745-PA 1..216 1..241 811 66.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9410-PB 242 CG9410-PB 1..242 1..242 1278 100 Plus
CG9410-PA 207 CG9410-PA 1..207 1..242 1047 85.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19293-PA 211 GI19293-PA 1..211 1..242 816 67.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11110-PA 207 GL11110-PA 1..207 1..242 907 74.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21766-PA 207 GA21766-PA 1..207 1..242 907 74.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20887-PA 207 GM20887-PA 1..207 1..242 1033 83.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10417-PA 207 GD10417-PA 1..207 1..242 1033 83.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22169-PA 210 GJ22169-PA 1..210 1..242 850 69.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23085-PA 148 GK23085-PA 1..148 95..242 659 81.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19067-PA 207 GE19067-PA 1..207 1..242 1005 81.8 Plus

IP16516.hyp Sequence

Translation from 549 to 1277

> IP16516.hyp
MLKGSTLKALDVRILWPLIETRSAGKCKLHNPRPTPNRNIAAAKLIVTLR
LLLSCCSGGHQRSFSSSTHRSYITFNDFRKKHRWYTKKELVGYSMQDMYS
VVSDVSNYHKFVPYVKRSDVHSRGSEGFKADLIVGFPPLNEAYTSQVTLV
PPSLVKSECHDGRLFNYLLNEWSFKPGLKDIPNSCVLDFKVSFEFKSLLH
SNVANIFFDLICDQMENAFIQEVRRRSGPPSIRSHVLTSDRS*

IP16516.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG9410-PB 242 CG9410-PB 1..242 1..242 1278 100 Plus
CG9410-PA 207 CG9410-PA 1..207 1..242 1047 85.5 Plus