Clone IP16804 Report

Search the DGRC for IP16804

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:168
Well:4
Vector:pOT2
Associated Gene/TranscriptCG34163-RA
Protein status:IP16804.pep: gold
Sequenced Size:480

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34163 2008-04-29 Release 5.5 accounting
CG34163 2008-08-15 Release 5.9 accounting
CG34163 2008-12-18 5.12 accounting

Clone Sequence Records

IP16804.complete Sequence

480 bp assembled on 2006-11-29

GenBank Submission: BT029554

> IP16804.complete
ACAACTTAACACGCGGAGATCTCCACATAAACAATGGAAATTAAAAAGTC
CAAGAAATCAAAGAACGACAAGAAGTCCAAGGCGCCCAAGGAGTCGTCCG
TTTCGCTCAAACTGAACGCTTTGCATCGCAAGCAAAAGGAAGTCGCCCGC
GTGCTCACTTTAAAACAAGAAATATTACTGAAATCGGGTGTATCCTATCT
GGAATATTATGAGATTCTGGCAGAAATCGAACGACTCAACGGCCTAAAGG
AGTCATTTATGCGCCGCGCTGATAAGCTGAAGCAACAGGACAAATAGTTG
ATAAGTTGGTTTGGTTTAGAAACTATATAAGAGTAAAGAAATCTGTAGCA
GTTATATTTCGGAATGTTTTGTACATACATACATGTAATCTTTTTTGTAA
TTAACTTTTATTTACTTAAAAGCTTTCAATAACATGATGAATAAAGTAGA
AAGTTATATATATAAAAAAAAAAAAAAAAA

IP16804.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34163-RA 576 CG34163-RA 27..490 1..464 2320 100 Plus
CG34163.a 484 CG34163.a 25..484 1..463 2245 99.3 Plus
zuc-RA 1127 zuc-RA 1060..1127 464..397 340 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11987037..11987454 46..463 2090 100 Plus
chr2L 23010047 chr2L 11986938..11986982 1..45 225 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11988384..11988802 46..464 2095 100 Plus
2L 23513712 2L 11988285..11988329 1..45 225 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11988384..11988802 46..464 2095 100 Plus
2L 23513712 2L 11988285..11988329 1..45 225 100 Plus
Blast to na_te.dros performed 2019-03-17 00:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 4393..4518 438..310 133 59.2 Minus
Dbuz\BuT5 669 Dbuz\BuT5 BUT5 669bp 140..188 404..454 115 75 Plus

IP16804.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:04:31 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11986938..11986982 1..45 100 -> Plus
chr2L 11987037..11987454 46..463 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:37 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:16:47 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:28:41 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:27:39 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:08:34 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:45:20 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 1..463 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:16:47 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 16..478 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:28:41 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 16..478 1..463 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:27:40 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 1..463 1..463 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:08:34 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
CG34163-RA 16..478 1..463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:31 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988285..11988329 1..45 100 -> Plus
2L 11988384..11988801 46..463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:31 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988285..11988329 1..45 100 -> Plus
2L 11988384..11988801 46..463 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:31 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988285..11988329 1..45 100 -> Plus
2L 11988384..11988801 46..463 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:28:41 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11988285..11988329 1..45 100 -> Plus
arm_2L 11988384..11988801 46..463 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:47:00 Download gff for IP16804.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11988285..11988329 1..45 100 -> Plus
2L 11988384..11988801 46..463 100   Plus

IP16804.pep Sequence

Translation from 33 to 296

> IP16804.pep
MEIKKSKKSKNDKKSKAPKESSVSLKLNALHRKQKEVARVLTLKQEILLK
SGVSYLEYYEILAEIERLNGLKESFMRRADKLKQQDK*

IP16804.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23750-PA 87 GG23750-PA 1..87 1..87 306 88.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34163-PA 87 CG34163-PA 1..87 1..87 421 100 Plus
CG34163-PB 86 CG34163-PB 1..86 1..87 404 98.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18537-PA 83 GL18537-PA 18..83 22..87 234 72.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25682-PA 83 GA25682-PA 18..83 22..87 234 72.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26680-PA 87 GM26680-PA 1..87 1..87 323 92 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23802-PA 87 GD23802-PA 1..87 1..87 331 94.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18557-PA 87 GE18557-PA 1..87 1..87 267 90.8 Plus

IP16804.hyp Sequence

Translation from 33 to 296

> IP16804.hyp
MEIKKSKKSKNDKKSKAPKESSVSLKLNALHRKQKEVARVLTLKQEILLK
SGVSYLEYYEILAEIERLNGLKESFMRRADKLKQQDK*

IP16804.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG34163-PA 87 CG34163-PA 1..87 1..87 421 100 Plus
CG34163-PB 86 CG34163-PB 1..86 1..87 404 98.9 Plus