IP16804.complete Sequence
480 bp assembled on 2006-11-29
GenBank Submission: BT029554
> IP16804.complete
ACAACTTAACACGCGGAGATCTCCACATAAACAATGGAAATTAAAAAGTC
CAAGAAATCAAAGAACGACAAGAAGTCCAAGGCGCCCAAGGAGTCGTCCG
TTTCGCTCAAACTGAACGCTTTGCATCGCAAGCAAAAGGAAGTCGCCCGC
GTGCTCACTTTAAAACAAGAAATATTACTGAAATCGGGTGTATCCTATCT
GGAATATTATGAGATTCTGGCAGAAATCGAACGACTCAACGGCCTAAAGG
AGTCATTTATGCGCCGCGCTGATAAGCTGAAGCAACAGGACAAATAGTTG
ATAAGTTGGTTTGGTTTAGAAACTATATAAGAGTAAAGAAATCTGTAGCA
GTTATATTTCGGAATGTTTTGTACATACATACATGTAATCTTTTTTGTAA
TTAACTTTTATTTACTTAAAAGCTTTCAATAACATGATGAATAAAGTAGA
AAGTTATATATATAAAAAAAAAAAAAAAAA
IP16804.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:11:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34163-RA | 576 | CG34163-RA | 27..490 | 1..464 | 2320 | 100 | Plus |
CG34163.a | 484 | CG34163.a | 25..484 | 1..463 | 2245 | 99.3 | Plus |
zuc-RA | 1127 | zuc-RA | 1060..1127 | 464..397 | 340 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:03:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 11987037..11987454 | 46..463 | 2090 | 100 | Plus |
chr2L | 23010047 | chr2L | 11986938..11986982 | 1..45 | 225 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:03:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11988384..11988802 | 46..464 | 2095 | 100 | Plus |
2L | 23513712 | 2L | 11988285..11988329 | 1..45 | 225 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11988384..11988802 | 46..464 | 2095 | 100 | Plus |
2L | 23513712 | 2L | 11988285..11988329 | 1..45 | 225 | 100 | Plus |
Blast to na_te.dros performed 2019-03-17 00:03:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
roo | 9092 | roo DM_ROO 9092bp | 4393..4518 | 438..310 | 133 | 59.2 | Minus |
Dbuz\BuT5 | 669 | Dbuz\BuT5 BUT5 669bp | 140..188 | 404..454 | 115 | 75 | Plus |
IP16804.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:04:31 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 11986938..11986982 | 1..45 | 100 | -> | Plus |
chr2L | 11987037..11987454 | 46..463 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:37 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 1..264 | 34..297 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:16:47 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 1..264 | 34..297 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:28:41 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 1..264 | 34..297 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:27:39 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 1..264 | 34..297 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:08:34 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 1..264 | 34..297 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:45:20 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 1..463 | 1..463 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:16:47 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 16..478 | 1..463 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:28:41 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 16..478 | 1..463 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:27:40 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 1..463 | 1..463 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:08:34 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34163-RA | 16..478 | 1..463 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:31 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11988285..11988329 | 1..45 | 100 | -> | Plus |
2L | 11988384..11988801 | 46..463 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:31 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11988285..11988329 | 1..45 | 100 | -> | Plus |
2L | 11988384..11988801 | 46..463 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:31 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11988285..11988329 | 1..45 | 100 | -> | Plus |
2L | 11988384..11988801 | 46..463 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:28:41 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11988285..11988329 | 1..45 | 100 | -> | Plus |
arm_2L | 11988384..11988801 | 46..463 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:47:00 Download gff for
IP16804.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11988285..11988329 | 1..45 | 100 | -> | Plus |
2L | 11988384..11988801 | 46..463 | 100 | | Plus |
IP16804.pep Sequence
Translation from 33 to 296
> IP16804.pep
MEIKKSKKSKNDKKSKAPKESSVSLKLNALHRKQKEVARVLTLKQEILLK
SGVSYLEYYEILAEIERLNGLKESFMRRADKLKQQDK*
IP16804.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:59:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23750-PA | 87 | GG23750-PA | 1..87 | 1..87 | 306 | 88.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34163-PA | 87 | CG34163-PA | 1..87 | 1..87 | 421 | 100 | Plus |
CG34163-PB | 86 | CG34163-PB | 1..86 | 1..87 | 404 | 98.9 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:59:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL18537-PA | 83 | GL18537-PA | 18..83 | 22..87 | 234 | 72.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:59:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25682-PA | 83 | GA25682-PA | 18..83 | 22..87 | 234 | 72.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:59:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26680-PA | 87 | GM26680-PA | 1..87 | 1..87 | 323 | 92 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:59:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23802-PA | 87 | GD23802-PA | 1..87 | 1..87 | 331 | 94.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:59:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18557-PA | 87 | GE18557-PA | 1..87 | 1..87 | 267 | 90.8 | Plus |
IP16804.hyp Sequence
Translation from 33 to 296
> IP16804.hyp
MEIKKSKKSKNDKKSKAPKESSVSLKLNALHRKQKEVARVLTLKQEILLK
SGVSYLEYYEILAEIERLNGLKESFMRRADKLKQQDK*
IP16804.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:22:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34163-PA | 87 | CG34163-PA | 1..87 | 1..87 | 421 | 100 | Plus |
CG34163-PB | 86 | CG34163-PB | 1..86 | 1..87 | 404 | 98.9 | Plus |