Clone IP16806 Report

Search the DGRC for IP16806

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:168
Well:6
Vector:pOT2
Associated Gene/TranscriptCG34167-RA
Protein status:IP16806.pep: gold
Sequenced Size:678

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34167 2008-04-29 Release 5.5 accounting
CG34167 2008-08-15 Release 5.9 accounting
CG34167 2008-12-18 5.12 accounting

Clone Sequence Records

IP16806.complete Sequence

678 bp assembled on 2006-11-29

GenBank Submission: BT029556

> IP16806.complete
GAAACTGCAAGAGTTTTTATTCGACAGGAATTATAAAATTTTCCCAGTGG
ACTTGTGACTATTGGCGGACAAAAAAGGTGCTAAATAGGCGCCTGGAGCT
GTGAGCTGACTGTCCATCACTGCCCCGGAGTATTTAGCATTTTTTTTAGC
GGCAAGTACTTAGCAACAGGTTGCAAAGGGCTAAGTAATTTCTAGGATGA
GTTGTGCTGCACCGCGATGCCGACCGCAGTTTGGATCCTGTGGGTCTGGT
TGTAAGCCCTGCGGCGGAGGTGGCTGCTGTGGATCCTGCTGTGTTGGTGG
TTCCTGTTGCAGGGGCGGTACAGGAGGATGCTGCGGCGGATCCTGCGGCG
GATCATGTGGCGGTTCATGTGGTGGATCCAGTGGCGGATGCTGTGGCCCA
CCGCCCTGTGCCGTGGTCTCGTACCGCTTGACCTACGGCCCCGTGGGTCC
CCTGCTGCCCTGCATGAAATGCACCTGCAACTGCGGATGTTGCAGCGGCG
GTTGTGCGCCACCTTTCTATTTTGTGCCTAACAAATGCAAAAATTGCTGG
GAATGGGGCTGCTTTGGCCCGCTGTACTAATACCCTGTAGTACCCTGTTG
TTGCACTTTTTATTGGAACTTTTCATATTTTTGAATGCAATAAATTCACG
TGTCAGCCAGAAAAAAAAAAAAAAAAAA

IP16806.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34167-RA 661 CG34167-RA 2..661 1..660 3285 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16001770..16002429 660..1 3270 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16002980..16003640 661..1 3290 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16002980..16003640 661..1 3290 99.8 Minus
Blast to na_te.dros performed 2019-03-16 19:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1346..1386 646..607 112 78 Minus

IP16806.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:02:21 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16001770..16002040 390..660 99 == Minus
chr2L 16002096..16002429 1..334 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:41 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 1..384 197..580 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:25 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 1..384 197..580 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:25 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 1..384 197..580 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:06:43 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 1..384 197..580 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:13 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 1..384 197..580 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:12 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 2..661 1..660 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:25 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 2..661 1..660 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:25 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 2..661 1..660 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:06:43 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 2..661 1..660 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:13 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
CG34167-RA 2..661 1..660 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:21 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16002981..16003640 1..660 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:21 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16002981..16003640 1..660 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:21 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16002981..16003640 1..660 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:25 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16002981..16003640 1..660 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:26 Download gff for IP16806.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16002981..16003640 1..660 99   Minus

IP16806.hyp Sequence

Translation from 196 to 579

> IP16806.hyp
MSCAAPRCRPQFGSCGSGCKPCGGGGCCGSCCVGGSCCRGGTGGCCGGSC
GGSCGGSCGGSSGGCCGPPPCAVVSYRLTYGPVGPLLPCMKCTCNCGCCS
GGCAPPFYFVPNKCKNCWEWGCFGPLY*

IP16806.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34167-PA 127 CG34167-PA 1..127 1..127 811 100 Plus
Pif2-PA 118 CG31483-PA 6..79 15..105 152 36.6 Plus
CG31820-PB 62 CG31820-PB 2..62 66..127 150 48.4 Plus
CG31820-PA 62 CG31820-PA 2..62 66..127 150 48.4 Plus
Pif2-PA 118 CG31483-PA 8..107 2..106 149 35.5 Plus
Mst84Da-PA 63 CG17946-PA 14..61 16..68 147 59.3 Plus

IP16806.pep Sequence

Translation from 196 to 579

> IP16806.pep
MSCAAPRCRPQFGSCGSGCKPCGGGGCCGSCCVGGSCCRGGTGGCCGGSC
GGSCGGSCGGSSGGCCGPPPCAVVSYRLTYGPVGPLLPCMKCTCNCGCCS
GGCAPPFYFVPNKCKNCWEWGCFGPLY*

IP16806.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14963-PA 143 GF14963-PA 89..143 72..127 225 80.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11349-PA 93 GH11349-PA 18..93 47..127 164 60.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34167-PA 127 CG34167-PA 1..127 1..127 811 100 Plus
Pif2-PA 118 CG31483-PA 6..79 15..105 152 36.6 Plus
CG31820-PB 62 CG31820-PB 2..62 66..127 150 48.4 Plus
CG31820-PA 62 CG31820-PA 2..62 66..127 150 48.4 Plus
Pif2-PA 118 CG31483-PA 8..107 2..106 149 35.5 Plus
Mst84Da-PA 63 CG17946-PA 14..61 16..68 147 59.3 Plus
Mst98Ca-PA 334 CG11719-PA 200..305 4..118 145 34.9 Plus
Mst84Db-PA 74 CG17934-PA 15..67 15..68 141 56.1 Plus
Mst84Dd-PA 72 CG17935-PA 2..56 18..89 135 45.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15318-PA 145 GL15318-PA 88..145 70..127 204 72.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28792-PA 139 GA28792-PA 84..139 72..127 195 71.4 Plus