IP16806.complete Sequence
678 bp assembled on 2006-11-29
GenBank Submission: BT029556
> IP16806.complete
GAAACTGCAAGAGTTTTTATTCGACAGGAATTATAAAATTTTCCCAGTGG
ACTTGTGACTATTGGCGGACAAAAAAGGTGCTAAATAGGCGCCTGGAGCT
GTGAGCTGACTGTCCATCACTGCCCCGGAGTATTTAGCATTTTTTTTAGC
GGCAAGTACTTAGCAACAGGTTGCAAAGGGCTAAGTAATTTCTAGGATGA
GTTGTGCTGCACCGCGATGCCGACCGCAGTTTGGATCCTGTGGGTCTGGT
TGTAAGCCCTGCGGCGGAGGTGGCTGCTGTGGATCCTGCTGTGTTGGTGG
TTCCTGTTGCAGGGGCGGTACAGGAGGATGCTGCGGCGGATCCTGCGGCG
GATCATGTGGCGGTTCATGTGGTGGATCCAGTGGCGGATGCTGTGGCCCA
CCGCCCTGTGCCGTGGTCTCGTACCGCTTGACCTACGGCCCCGTGGGTCC
CCTGCTGCCCTGCATGAAATGCACCTGCAACTGCGGATGTTGCAGCGGCG
GTTGTGCGCCACCTTTCTATTTTGTGCCTAACAAATGCAAAAATTGCTGG
GAATGGGGCTGCTTTGGCCCGCTGTACTAATACCCTGTAGTACCCTGTTG
TTGCACTTTTTATTGGAACTTTTCATATTTTTGAATGCAATAAATTCACG
TGTCAGCCAGAAAAAAAAAAAAAAAAAA
IP16806.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:04:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34167-RA | 661 | CG34167-RA | 2..661 | 1..660 | 3285 | 99.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:01:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 16001770..16002429 | 660..1 | 3270 | 99.7 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:01:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16002980..16003640 | 661..1 | 3290 | 99.8 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16002980..16003640 | 661..1 | 3290 | 99.8 | Minus |
Blast to na_te.dros performed 2019-03-16 19:01:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 1346..1386 | 646..607 | 112 | 78 | Minus |
IP16806.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:02:21 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 16001770..16002040 | 390..660 | 99 | == | Minus |
chr2L | 16002096..16002429 | 1..334 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:41 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 1..384 | 197..580 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:25 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 1..384 | 197..580 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:25 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 1..384 | 197..580 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:06:43 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 1..384 | 197..580 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:13 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 1..384 | 197..580 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:12 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 2..661 | 1..660 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:25 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 2..661 | 1..660 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:25 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 2..661 | 1..660 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:06:43 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 2..661 | 1..660 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:13 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34167-RA | 2..661 | 1..660 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:21 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16002981..16003640 | 1..660 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:21 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16002981..16003640 | 1..660 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:21 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16002981..16003640 | 1..660 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:25 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16002981..16003640 | 1..660 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:26 Download gff for
IP16806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16002981..16003640 | 1..660 | 99 | | Minus |
IP16806.hyp Sequence
Translation from 196 to 579
> IP16806.hyp
MSCAAPRCRPQFGSCGSGCKPCGGGGCCGSCCVGGSCCRGGTGGCCGGSC
GGSCGGSCGGSSGGCCGPPPCAVVSYRLTYGPVGPLLPCMKCTCNCGCCS
GGCAPPFYFVPNKCKNCWEWGCFGPLY*
IP16806.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34167-PA | 127 | CG34167-PA | 1..127 | 1..127 | 811 | 100 | Plus |
Pif2-PA | 118 | CG31483-PA | 6..79 | 15..105 | 152 | 36.6 | Plus |
CG31820-PB | 62 | CG31820-PB | 2..62 | 66..127 | 150 | 48.4 | Plus |
CG31820-PA | 62 | CG31820-PA | 2..62 | 66..127 | 150 | 48.4 | Plus |
Pif2-PA | 118 | CG31483-PA | 8..107 | 2..106 | 149 | 35.5 | Plus |
Mst84Da-PA | 63 | CG17946-PA | 14..61 | 16..68 | 147 | 59.3 | Plus |
IP16806.pep Sequence
Translation from 196 to 579
> IP16806.pep
MSCAAPRCRPQFGSCGSGCKPCGGGGCCGSCCVGGSCCRGGTGGCCGGSC
GGSCGGSCGGSSGGCCGPPPCAVVSYRLTYGPVGPLLPCMKCTCNCGCCS
GGCAPPFYFVPNKCKNCWEWGCFGPLY*
IP16806.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14963-PA | 143 | GF14963-PA | 89..143 | 72..127 | 225 | 80.4 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:39:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH11349-PA | 93 | GH11349-PA | 18..93 | 47..127 | 164 | 60.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34167-PA | 127 | CG34167-PA | 1..127 | 1..127 | 811 | 100 | Plus |
Pif2-PA | 118 | CG31483-PA | 6..79 | 15..105 | 152 | 36.6 | Plus |
CG31820-PB | 62 | CG31820-PB | 2..62 | 66..127 | 150 | 48.4 | Plus |
CG31820-PA | 62 | CG31820-PA | 2..62 | 66..127 | 150 | 48.4 | Plus |
Pif2-PA | 118 | CG31483-PA | 8..107 | 2..106 | 149 | 35.5 | Plus |
Mst84Da-PA | 63 | CG17946-PA | 14..61 | 16..68 | 147 | 59.3 | Plus |
Mst98Ca-PA | 334 | CG11719-PA | 200..305 | 4..118 | 145 | 34.9 | Plus |
Mst84Db-PA | 74 | CG17934-PA | 15..67 | 15..68 | 141 | 56.1 | Plus |
Mst84Dd-PA | 72 | CG17935-PA | 2..56 | 18..89 | 135 | 45.9 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:39:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL15318-PA | 145 | GL15318-PA | 88..145 | 70..127 | 204 | 72.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:39:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA28792-PA | 139 | GA28792-PA | 84..139 | 72..127 | 195 | 71.4 | Plus |