IP16809.complete Sequence
333 bp assembled on 2006-11-28
GenBank Submission: BT029557
> IP16809.complete
TCGGCCTTTAGAAAAACTTCAAAATTTGTGGCTTAAATTTGGGGAGCCGG
AAAAATATTCCATGGCTGGATCACCTGGCGTTAAGGATAAGCTGAATCTG
ATTGTTGGCGGGGACATTTGCGAGGTATACCGGGATGGATTCAATTGCGG
ATCCTTTGGCTTCTGGTGCGGACTCGTCGGATTGGCCGTCTTCATAATTT
TTCTCGCCTACTTTCATATAAATCGGGAGCGAATAGATCCGACGTCATAA
TCCCCCTAAATGTGGACAATTCTACATAAATGTGTCATAAATAAAAAGTA
ATTTAAAAAAAAGTAAAAAAAAAAAAAAAAAAA
IP16809.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:03:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-RA | 314 | CG34170-RA | 1..314 | 1..314 | 1570 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:09:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 17310235..17310548 | 314..1 | 1570 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 17311506..17311820 | 315..1 | 1575 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 17311506..17311820 | 315..1 | 1575 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 10:08:59 has no hits.
IP16809.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:10:05 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 17310235..17310548 | 1..314 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:44 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..189 | 62..250 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:07 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..189 | 62..250 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:51 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..189 | 62..250 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:12 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..189 | 62..250 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:08 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..189 | 62..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:22 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..314 | 1..314 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:07 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..314 | 1..314 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:51 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..314 | 1..314 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:13 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..314 | 1..314 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:08 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34170-RA | 1..314 | 1..314 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:05 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17311507..17311820 | 1..314 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:05 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17311507..17311820 | 1..314 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:05 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17311507..17311820 | 1..314 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:51 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 17311507..17311820 | 1..314 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:52 Download gff for
IP16809.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 17311507..17311820 | 1..314 | 100 | | Minus |
IP16809.hyp Sequence
Translation from 0 to 249
> IP16809.hyp
RPLEKLQNLWLKFGEPEKYSMAGSPGVKDKLNLIVGGDICEVYRDGFNCG
SFGFWCGLVGLAVFIIFLAYFHINRERIDPTS*
IP16809.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-PB | 62 | CG34170-PB | 1..62 | 21..82 | 339 | 100 | Plus |
CG34170-PA | 62 | CG34170-PA | 1..62 | 21..82 | 339 | 100 | Plus |
IP16809.pep Sequence
Translation from 1 to 249
> IP16809.pep
RPLEKLQNLWLKFGEPEKYSMAGSPGVKDKLNLIVGGDICEVYRDGFNCG
SFGFWCGLVGLAVFIIFLAYFHINRERIDPTS*
IP16809.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:58:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15109-PA | 62 | GF15109-PA | 1..62 | 21..82 | 187 | 54.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:58:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21752-PA | 62 | GG21752-PA | 1..62 | 21..82 | 305 | 91.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34170-PB | 62 | CG34170-PB | 1..62 | 21..82 | 339 | 100 | Plus |
CG34170-PA | 62 | CG34170-PA | 1..62 | 21..82 | 339 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:58:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17135-PA | 62 | GM17135-PA | 1..61 | 21..81 | 315 | 98.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:58:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21876-PA | 62 | GD21876-PA | 1..61 | 21..81 | 314 | 96.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:58:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13142-PA | 62 | GE13142-PA | 1..62 | 21..82 | 315 | 95.2 | Plus |