Clone IP16809 Report

Search the DGRC for IP16809

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:168
Well:9
Vector:pOT2
Associated Gene/TranscriptCG34170-RA
Protein status:IP16809.pep: gold
Sequenced Size:333

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34170 2008-04-29 Release 5.5 accounting
CG34170 2008-08-15 Release 5.9 accounting
CG34170 2008-12-18 5.12 accounting

Clone Sequence Records

IP16809.complete Sequence

333 bp assembled on 2006-11-28

GenBank Submission: BT029557

> IP16809.complete
TCGGCCTTTAGAAAAACTTCAAAATTTGTGGCTTAAATTTGGGGAGCCGG
AAAAATATTCCATGGCTGGATCACCTGGCGTTAAGGATAAGCTGAATCTG
ATTGTTGGCGGGGACATTTGCGAGGTATACCGGGATGGATTCAATTGCGG
ATCCTTTGGCTTCTGGTGCGGACTCGTCGGATTGGCCGTCTTCATAATTT
TTCTCGCCTACTTTCATATAAATCGGGAGCGAATAGATCCGACGTCATAA
TCCCCCTAAATGTGGACAATTCTACATAAATGTGTCATAAATAAAAAGTA
ATTTAAAAAAAAGTAAAAAAAAAAAAAAAAAAA

IP16809.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-RA 314 CG34170-RA 1..314 1..314 1570 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17310235..17310548 314..1 1570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17311506..17311820 315..1 1575 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17311506..17311820 315..1 1575 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:08:59 has no hits.

IP16809.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:10:05 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17310235..17310548 1..314 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:44 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..189 62..250 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:07 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..189 62..250 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:51 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..189 62..250 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:12 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..189 62..250 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:08 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..189 62..250 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:22 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..314 1..314 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:07 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..314 1..314 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:51 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..314 1..314 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:13 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..314 1..314 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:08 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
CG34170-RA 1..314 1..314 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:05 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17311507..17311820 1..314 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:05 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17311507..17311820 1..314 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:10:05 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17311507..17311820 1..314 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:51 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17311507..17311820 1..314 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:52 Download gff for IP16809.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17311507..17311820 1..314 100   Minus

IP16809.hyp Sequence

Translation from 0 to 249

> IP16809.hyp
RPLEKLQNLWLKFGEPEKYSMAGSPGVKDKLNLIVGGDICEVYRDGFNCG
SFGFWCGLVGLAVFIIFLAYFHINRERIDPTS*

IP16809.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-PB 62 CG34170-PB 1..62 21..82 339 100 Plus
CG34170-PA 62 CG34170-PA 1..62 21..82 339 100 Plus

IP16809.pep Sequence

Translation from 1 to 249

> IP16809.pep
RPLEKLQNLWLKFGEPEKYSMAGSPGVKDKLNLIVGGDICEVYRDGFNCG
SFGFWCGLVGLAVFIIFLAYFHINRERIDPTS*

IP16809.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15109-PA 62 GF15109-PA 1..62 21..82 187 54.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21752-PA 62 GG21752-PA 1..62 21..82 305 91.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34170-PB 62 CG34170-PB 1..62 21..82 339 100 Plus
CG34170-PA 62 CG34170-PA 1..62 21..82 339 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17135-PA 62 GM17135-PA 1..61 21..81 315 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21876-PA 62 GD21876-PA 1..61 21..81 314 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13142-PA 62 GE13142-PA 1..62 21..82 315 95.2 Plus