Clone IP16821 Report

Search the DGRC for IP16821

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:168
Well:21
Vector:pOT2
Associated Gene/TranscriptCG34175-RA
Protein status:IP16821.pep: gold
Sequenced Size:714

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34175 2008-04-29 Release 5.5 accounting
CG34175 2008-08-15 Release 5.9 accounting
CG34175 2008-12-18 5.12 accounting

Clone Sequence Records

IP16821.complete Sequence

714 bp assembled on 2006-11-28

GenBank Submission: BT029559

> IP16821.complete
AGAACTAGTCTCGAGTTTTTTTTTTTTTTTTTGTCTCAGAAAATGTCACT
TTTTGGTAAAATTTTAGAAAAATTTACAGAAATTAATTTGATTAAATTGT
AAGTTTCCGATCTCGGATATTTCCCTACTTTCCTTCAGAATGGTGTGCCG
CTTCAATCCCTTTTACATTGGACCAACTCCACCCAGCTGCTGCACGGATT
TGAAGTCCGATTGCGATTGCCCGCCGTGCTCACCGGATACAGGGTATCAG
GAGCCTCGACCCGTTCACGAGGAGTGCAACCCGGGTGTGCCGAAGAAGGA
GACCAAGGAGAGCAAGTGCAATCCTCCTTGCAAAGAAGCCCCCAAAAAGG
AAAAGAAGGAGAAGAAGTCCGAGAATAAAGAGGCTAAAAAAACTAAATAA
ATTTAAGTTTTGCTAGAAATTTGTAACATAGAATAGCCTTTTTTAAACAC
AACATTGAATCGTGCTGGCTACGAATGAGCATCGAACTTGGCTTGTTAAA
ATTCAATTACACGCAGCTCGCAGCTACAAAACTGAATCCATTTATGCACC
ATATCAAATCAAAGTCAACCGCAAAAATATATTTTCAAATTGAATTCTCC
CATAAGAGAAAGGCACAAACGTGAAGAAGCGGTCATAAAAACTCAATAAA
CGGCAATAACGCTTGATATACGTATACGTATATAAAAATAAAAAAAAAAA
AAAAAAAAAAAAAA

IP16821.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-RA 662 CG34175-RA 1..662 28..689 3310 100 Plus
CG34175.a 620 CG34175.a 69..620 138..689 2760 100 Plus
CG34175.a 620 CG34175.a 42..69 28..55 140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3397664..3398319 28..689 3035 97.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3398023..3398685 28..690 3315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3398023..3398685 28..690 3315 100 Plus
Blast to na_te.dros performed 2019-03-16 13:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
hopper 1435 hopper DMTRDNA 1435bp Derived from X80025 (g510507) (Rel. 44, Last updated, Version 11). 168..217 589..540 106 68 Minus

IP16821.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:23:22 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3397661..3398319 28..689 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:03:53 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..261 140..400 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:18:20 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..261 140..400 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:27:34 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..261 140..400 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:30:44 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..261 140..400 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:14 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..261 140..400 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:46:35 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..662 28..689 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:18:20 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..662 28..689 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:27:34 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..662 28..689 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:30:47 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..662 28..689 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:14 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 1..662 28..689 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:22 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3398020..3398684 28..689 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:22 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3398020..3398684 28..689 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:22 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3398020..3398684 28..689 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:27:34 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3398020..3398684 28..689 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:02 Download gff for IP16821.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3398020..3398684 28..689 99   Plus

IP16821.hyp Sequence

Translation from 139 to 399

> IP16821.hyp
MVCRFNPFYIGPTPPSCCTDLKSDCDCPPCSPDTGYQEPRPVHEECNPGV
PKKETKESKCNPPCKEAPKKEKKEKKSENKEAKKTK*

IP16821.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-PA 86 CG34175-PA 1..86 1..86 502 100 Plus

IP16821.pep Sequence

Translation from 139 to 399

> IP16821.pep
MVCRFNPFYIGPTPPSCCTDLKSDCDCPPCSPDTGYQEPRPVHEECNPGV
PKKETKESKCNPPCKEAPKKEKKEKKSENKEAKKTK*

IP16821.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14183-PA 87 GF14183-PA 1..84 1..84 271 67.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24937-PA 86 GG24937-PA 1..86 1..86 408 96.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-PA 86 CG34175-PA 1..86 1..86 502 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25718-PA 92 GA25718-PA 1..50 1..49 178 70 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18414-PA 86 GM18414-PA 1..86 1..86 328 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23226-PA 86 GD23226-PA 1..86 1..86 408 96.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14595-PA 112 GK14595-PA 1..45 1..40 149 68.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18229-PA 86 GE18229-PA 1..68 1..68 329 95.6 Plus