BDGP Sequence Production Resources |
Search the DGRC for IP16852
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 168 |
Well: | 52 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34203-RA |
Protein status: | IP16852.pep: gold |
Sequenced Size: | 545 |
Gene | Date | Evidence |
---|---|---|
CG34203 | 2008-04-29 | Release 5.5 accounting |
CG34203 | 2008-08-15 | Release 5.9 accounting |
CG34203 | 2008-12-18 | 5.12 accounting |
545 bp assembled on 2006-11-28
GenBank Submission: BT029565
> IP16852.complete AAAGAACAAGTCGATTTTATATCAGTACTTAAAATCTAAAAAACTTACCA TTAAAATGCGTTGCAACAAGATTATTTTCCAACTTATTGCCTGTTTTGTG ATCATTGAGCTTGTGCTCGGTTATCCCCAAGATCGTTTCACATCAGCGGA ACAGATTCAACAACTAAGTGATGCCAATGAAGGGGATGCTCATCCAGAGA TCTCTTCCAGCAGTGAAACCCTTAGAAATTTATACAGATACGAGCGCACT CTGAGCAGATTACGAAGAGCTCTGGAGGAGTTGGCCTATGAGGAGGCGGC CGATGATATGGAACTGGCCGAGATTAATGTTTTCCGGCCACTCTTCCGTT ACCGATCTCAGGTGGTGAAGGTGAAGAATCCGCAGCAGCAGTTTGGTTAA CTAAACTCTTTAGTCTTAAGATCATCGCCTCATCTAATGTCAATAGATAG TCATATGCCATTGATATCTTTTATACAAACCTAGCCTGTTAAGGAGTAAT ATAGAACTTATTTATATTGTTAAACAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 17167561..17168016 | 71..525 | 97 | <- | Minus |
chr2R | 17168076..17168145 | 1..70 | 94 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 1..345 | 56..400 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 1..345 | 56..400 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 1..345 | 56..400 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 1..345 | 56..400 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 1..345 | 56..400 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 7..531 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 7..531 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 7..531 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 7..531 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34203-RA | 7..531 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21281067..21281521 | 71..525 | 100 | <- | Minus |
2R | 21281581..21281650 | 1..70 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21281067..21281521 | 71..525 | 100 | <- | Minus |
2R | 21281581..21281650 | 1..70 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21281067..21281521 | 71..525 | 100 | <- | Minus |
2R | 21281581..21281650 | 1..70 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 17168572..17169026 | 71..525 | 100 | <- | Minus |
arm_2R | 17169086..17169155 | 1..70 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 21282266..21282720 | 71..525 | 100 | <- | Minus |
2R | 21282780..21282849 | 1..70 | 100 | Minus |
Translation from 0 to 399
> IP16852.hyp KNKSILYQYLKSKKLTIKMRCNKIIFQLIACFVIIELVLGYPQDRFTSAE QIQQLSDANEGDAHPEISSSSETLRNLYRYERTLSRLRRALEELAYEEAA DDMELAEINVFRPLFRYRSQVVKVKNPQQQFG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34203-PA | 114 | CG34203-PA | 1..114 | 19..132 | 575 | 100 | Plus |
Translation from 1 to 399
> IP16852.pep KNKSILYQYLKSKKLTIKMRCNKIIFQLIACFVIIELVLGYPQDRFTSAE QIQQLSDANEGDAHPEISSSSETLRNLYRYERTLSRLRRALEELAYEEAA DDMELAEINVFRPLFRYRSQVVKVKNPQQQFG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12110-PA | 112 | GF12110-PA | 1..112 | 19..132 | 374 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20789-PA | 113 | GG20789-PA | 1..113 | 19..132 | 492 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20031-PA | 65 | GH20031-PA | 8..63 | 76..130 | 186 | 66.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34203-PA | 114 | CG34203-PA | 1..114 | 19..132 | 575 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19209-PA | 107 | GI19209-PA | 1..107 | 19..132 | 233 | 49.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10758-PA | 113 | GL10758-PA | 1..113 | 19..132 | 391 | 69.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24472-PA | 113 | GA24472-PA | 1..113 | 19..132 | 391 | 69.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15735-PA | 112 | GM15735-PA | 1..112 | 19..132 | 552 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25212-PA | 114 | GD25212-PA | 1..114 | 19..132 | 577 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20279-PA | 111 | GJ20279-PA | 1..111 | 19..132 | 267 | 52.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21660-PA | 108 | GK21660-PA | 1..108 | 19..132 | 276 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13727-PA | 114 | GE13727-PA | 1..114 | 19..132 | 473 | 86.8 | Plus |