Clone IP16852 Report

Search the DGRC for IP16852

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:168
Well:52
Vector:pOT2
Associated Gene/TranscriptCG34203-RA
Protein status:IP16852.pep: gold
Sequenced Size:545

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34203 2008-04-29 Release 5.5 accounting
CG34203 2008-08-15 Release 5.9 accounting
CG34203 2008-12-18 5.12 accounting

Clone Sequence Records

IP16852.complete Sequence

545 bp assembled on 2006-11-28

GenBank Submission: BT029565

> IP16852.complete
AAAGAACAAGTCGATTTTATATCAGTACTTAAAATCTAAAAAACTTACCA
TTAAAATGCGTTGCAACAAGATTATTTTCCAACTTATTGCCTGTTTTGTG
ATCATTGAGCTTGTGCTCGGTTATCCCCAAGATCGTTTCACATCAGCGGA
ACAGATTCAACAACTAAGTGATGCCAATGAAGGGGATGCTCATCCAGAGA
TCTCTTCCAGCAGTGAAACCCTTAGAAATTTATACAGATACGAGCGCACT
CTGAGCAGATTACGAAGAGCTCTGGAGGAGTTGGCCTATGAGGAGGCGGC
CGATGATATGGAACTGGCCGAGATTAATGTTTTCCGGCCACTCTTCCGTT
ACCGATCTCAGGTGGTGAAGGTGAAGAATCCGCAGCAGCAGTTTGGTTAA
CTAAACTCTTTAGTCTTAAGATCATCGCCTCATCTAATGTCAATAGATAG
TCATATGCCATTGATATCTTTTATACAAACCTAGCCTGTTAAGGAGTAAT
ATAGAACTTATTTATATTGTTAAACAAAAAAAAAAAAAAAAAAAA

IP16852.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-RA 535 CG34203-RA 7..532 1..526 2630 100 Plus
CG34203.a 838 CG34203.a 7..532 1..526 2630 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17167561..17168018 525..69 2105 97.8 Minus
chr2R 21145070 chr2R 17168076..17168145 70..1 290 94.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21281066..21281523 526..69 2290 100 Minus
2R 25286936 2R 21281581..21281650 70..1 350 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21282265..21282722 526..69 2290 100 Minus
2R 25260384 2R 21282780..21282849 70..1 350 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:44:09 has no hits.

IP16852.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:45:12 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17167561..17168016 71..525 97 <- Minus
chr2R 17168076..17168145 1..70 94   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:04:10 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 1..345 56..400 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:18:22 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 1..345 56..400 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:40:27 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 1..345 56..400 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:31:35 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 1..345 56..400 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:07:20 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 1..345 56..400 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:46:37 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 7..531 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:18:22 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 7..531 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:40:27 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 7..531 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:31:38 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 7..531 1..525 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:07:20 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 7..531 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:45:12 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21281067..21281521 71..525 100 <- Minus
2R 21281581..21281650 1..70 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:45:12 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21281067..21281521 71..525 100 <- Minus
2R 21281581..21281650 1..70 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:45:12 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21281067..21281521 71..525 100 <- Minus
2R 21281581..21281650 1..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:40:27 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17168572..17169026 71..525 100 <- Minus
arm_2R 17169086..17169155 1..70 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:03 Download gff for IP16852.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21282266..21282720 71..525 100 <- Minus
2R 21282780..21282849 1..70 100   Minus

IP16852.hyp Sequence

Translation from 0 to 399

> IP16852.hyp
KNKSILYQYLKSKKLTIKMRCNKIIFQLIACFVIIELVLGYPQDRFTSAE
QIQQLSDANEGDAHPEISSSSETLRNLYRYERTLSRLRRALEELAYEEAA
DDMELAEINVFRPLFRYRSQVVKVKNPQQQFG*

IP16852.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-PA 114 CG34203-PA 1..114 19..132 575 100 Plus

IP16852.pep Sequence

Translation from 1 to 399

> IP16852.pep
KNKSILYQYLKSKKLTIKMRCNKIIFQLIACFVIIELVLGYPQDRFTSAE
QIQQLSDANEGDAHPEISSSSETLRNLYRYERTLSRLRRALEELAYEEAA
DDMELAEINVFRPLFRYRSQVVKVKNPQQQFG*

IP16852.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12110-PA 112 GF12110-PA 1..112 19..132 374 65.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20789-PA 113 GG20789-PA 1..113 19..132 492 81.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20031-PA 65 GH20031-PA 8..63 76..130 186 66.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-PA 114 CG34203-PA 1..114 19..132 575 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19209-PA 107 GI19209-PA 1..107 19..132 233 49.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10758-PA 113 GL10758-PA 1..113 19..132 391 69.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24472-PA 113 GA24472-PA 1..113 19..132 391 69.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15735-PA 112 GM15735-PA 1..112 19..132 552 93.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25212-PA 114 GD25212-PA 1..114 19..132 577 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20279-PA 111 GJ20279-PA 1..111 19..132 267 52.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21660-PA 108 GK21660-PA 1..108 19..132 276 54.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13727-PA 114 GE13727-PA 1..114 19..132 473 86.8 Plus