Clone IP16856 Report

Search the DGRC for IP16856

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:168
Well:56
Vector:pOT2
Associated Gene/TranscriptCG34210-RA
Protein status:IP16856.pep: gold
Sequenced Size:506

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34210 2008-04-29 Release 5.5 accounting
CG34210 2008-08-15 Release 5.9 accounting
CG34210 2008-12-18 5.12 accounting

Clone Sequence Records

IP16856.complete Sequence

506 bp assembled on 2006-11-28

GenBank Submission: BT029566.1

> IP16856.complete
CTTTGTCTACTACCAAGTCGAGCGCAAGATGAAGAAGTCCGGGGACTTTC
TCTCCCTGCTCAACAATCGCGACCTGCTGAAGACTCCGTCCGGCAACTCC
ATTGTGAACTTCCTGGTGAAACCGATGAGCGTGGAAATGAACACGGCGGA
CAATCTGATCACGGGTGCCAGGCGCCAGCGAATGATGGAGCTCTTCCAGG
AGGACCGCGCCTGGGAGGCCGCCGAGTTGTCCCGCTTCGGACTGAGCTGC
ATCAAGGCCCCGGACTGCTATCCCTGCTGCACTCCTTTCGAGTGCTCCAA
GGCCAAGTTCTAGGACTAATTGATACGTCTTTTATTGTATGTGTGTGAGA
ATCAAATCCATACGTAAATCAACCTTTAAATTTCATCCTCACAATAGAGG
ATTCGCATAGAAAGCTGGCCATACATATTTGATAGCCAACATTTTCCCGA
TTCTCTAGAAGATTAGAAAACAGACCGTAATTTCGTTTAAAAAAAAAAAA
AAAAAA

IP16856.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34210-RA 876 CG34210-RA 291..781 1..491 2455 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19238023..19238462 49..488 2200 100 Plus
chr2R 21145070 chr2R 19237913..19237960 1..48 240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23351705..23352147 49..491 2215 100 Plus
2R 25286936 2R 23351595..23351642 1..48 240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23352904..23353346 49..491 2215 100 Plus
2R 25260384 2R 23352794..23352841 1..48 240 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:56:08 has no hits.

IP16856.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:56:55 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19237913..19237960 1..48 100 -> Plus
chr2R 19238023..19238459 49..488 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:04:14 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:18:24 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:13 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:31:50 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:46:34 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 1..285 29..313 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:46:38 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 12..499 1..488 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:18:23 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 12..499 1..488 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:13 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 78..565 1..488 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:31:51 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 12..499 1..488 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:46:34 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 78..565 1..488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:55 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23351705..23352144 49..488 100   Plus
2R 23351595..23351642 1..48 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:55 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23351705..23352144 49..488 100   Plus
2R 23351595..23351642 1..48 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:55 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23351705..23352144 49..488 100   Plus
2R 23351595..23351642 1..48 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:13 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19239228..19239667 49..488 100   Plus
arm_2R 19239118..19239165 1..48 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:05 Download gff for IP16856.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23352812..23352859 1..48 100 -> Plus
2R 23352922..23353361 49..488 100   Plus

IP16856.hyp Sequence

Translation from 0 to 347

> IP16856.hyp
LCLLPSRAQDEEVRGLSLPAQQSRPAEDSVRQLHCELPGETDERGNEHGG
QSDHGCQAPANDGALPGGPRLGGRRVVPLRTELHQGPGLLSLLHSFRVLQ
GQVLGLIDTSFIVCV*
Sequence IP16856.hyp has no blast hits.

IP16856.pep Sequence

Translation from 1 to 312

> IP16856.pep
FVYYQVERKMKKSGDFLSLLNNRDLLKTPSGNSIVNFLVKPMSVEMNTAD
NLITGARRQRMMELFQEDRAWEAAELSRFGLSCIKAPDCYPCCTPFECSK
AKF*

IP16856.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11568-PA 94 GF11568-PA 1..94 10..103 456 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22841-PA 94 GG22841-PA 1..94 10..103 488 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22733-PA 95 GH22733-PA 4..90 15..102 130 33 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34210-PA 94 CG34210-PA 1..94 10..103 498 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10791-PA 250 GL10791-PA 163..250 14..103 217 54.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24490-PA 117 GA24490-PA 32..117 16..103 217 54.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15998-PA 94 GM15998-PA 1..94 10..103 500 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11751-PA 94 GD11751-PA 1..94 10..103 500 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14277-PA 94 GE14277-PA 1..94 10..103 489 97.9 Plus