IP16856.complete Sequence
506 bp assembled on 2006-11-28
GenBank Submission: BT029566.1
> IP16856.complete
CTTTGTCTACTACCAAGTCGAGCGCAAGATGAAGAAGTCCGGGGACTTTC
TCTCCCTGCTCAACAATCGCGACCTGCTGAAGACTCCGTCCGGCAACTCC
ATTGTGAACTTCCTGGTGAAACCGATGAGCGTGGAAATGAACACGGCGGA
CAATCTGATCACGGGTGCCAGGCGCCAGCGAATGATGGAGCTCTTCCAGG
AGGACCGCGCCTGGGAGGCCGCCGAGTTGTCCCGCTTCGGACTGAGCTGC
ATCAAGGCCCCGGACTGCTATCCCTGCTGCACTCCTTTCGAGTGCTCCAA
GGCCAAGTTCTAGGACTAATTGATACGTCTTTTATTGTATGTGTGTGAGA
ATCAAATCCATACGTAAATCAACCTTTAAATTTCATCCTCACAATAGAGG
ATTCGCATAGAAAGCTGGCCATACATATTTGATAGCCAACATTTTCCCGA
TTCTCTAGAAGATTAGAAAACAGACCGTAATTTCGTTTAAAAAAAAAAAA
AAAAAA
IP16856.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:11:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34210-RA | 876 | CG34210-RA | 291..781 | 1..491 | 2455 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:56:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 19238023..19238462 | 49..488 | 2200 | 100 | Plus |
chr2R | 21145070 | chr2R | 19237913..19237960 | 1..48 | 240 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23351705..23352147 | 49..491 | 2215 | 100 | Plus |
2R | 25286936 | 2R | 23351595..23351642 | 1..48 | 240 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 23352904..23353346 | 49..491 | 2215 | 100 | Plus |
2R | 25260384 | 2R | 23352794..23352841 | 1..48 | 240 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 19:56:08 has no hits.
IP16856.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:56:55 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 19237913..19237960 | 1..48 | 100 | -> | Plus |
chr2R | 19238023..19238459 | 49..488 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:04:14 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 1..285 | 29..313 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:18:24 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 1..285 | 29..313 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:13 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 1..285 | 29..313 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:31:50 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 1..285 | 29..313 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:46:34 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 1..285 | 29..313 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:46:38 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 12..499 | 1..488 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:18:23 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 12..499 | 1..488 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:13 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 78..565 | 1..488 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:31:51 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 12..499 | 1..488 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:46:34 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34210-RA | 78..565 | 1..488 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:55 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23351705..23352144 | 49..488 | 100 | | Plus |
2R | 23351595..23351642 | 1..48 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:55 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23351705..23352144 | 49..488 | 100 | | Plus |
2R | 23351595..23351642 | 1..48 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:55 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23351705..23352144 | 49..488 | 100 | | Plus |
2R | 23351595..23351642 | 1..48 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:13 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19239228..19239667 | 49..488 | 100 | | Plus |
arm_2R | 19239118..19239165 | 1..48 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:05 Download gff for
IP16856.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23352812..23352859 | 1..48 | 100 | -> | Plus |
2R | 23352922..23353361 | 49..488 | 100 | | Plus |
IP16856.hyp Sequence
Translation from 0 to 347
> IP16856.hyp
LCLLPSRAQDEEVRGLSLPAQQSRPAEDSVRQLHCELPGETDERGNEHGG
QSDHGCQAPANDGALPGGPRLGGRRVVPLRTELHQGPGLLSLLHSFRVLQ
GQVLGLIDTSFIVCV*
Sequence IP16856.hyp has no blast hits.
IP16856.pep Sequence
Translation from 1 to 312
> IP16856.pep
FVYYQVERKMKKSGDFLSLLNNRDLLKTPSGNSIVNFLVKPMSVEMNTAD
NLITGARRQRMMELFQEDRAWEAAELSRFGLSCIKAPDCYPCCTPFECSK
AKF*
IP16856.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:54:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF11568-PA | 94 | GF11568-PA | 1..94 | 10..103 | 456 | 88.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:54:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22841-PA | 94 | GG22841-PA | 1..94 | 10..103 | 488 | 97.9 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:54:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH22733-PA | 95 | GH22733-PA | 4..90 | 15..102 | 130 | 33 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34210-PA | 94 | CG34210-PA | 1..94 | 10..103 | 498 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:54:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10791-PA | 250 | GL10791-PA | 163..250 | 14..103 | 217 | 54.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:54:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA24490-PA | 117 | GA24490-PA | 32..117 | 16..103 | 217 | 54.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:54:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15998-PA | 94 | GM15998-PA | 1..94 | 10..103 | 500 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:54:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11751-PA | 94 | GD11751-PA | 1..94 | 10..103 | 500 | 100 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:54:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14277-PA | 94 | GE14277-PA | 1..94 | 10..103 | 489 | 97.9 | Plus |