Clone IP16890 Report

Search the DGRC for IP16890

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:168
Well:90
Vector:pOT2
Associated Gene/TranscriptCG34238-RA
Protein status:IP16890.pep: gold
Sequenced Size:723

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34238 2008-04-29 Release 5.5 accounting
CG34238 2008-08-15 Release 5.9 accounting
CG34238 2008-12-18 5.12 accounting

Clone Sequence Records

IP16890.complete Sequence

723 bp assembled on 2006-11-28

GenBank Submission: BT029572

> IP16890.complete
GTTTTCATTTTTCGATATGATCTCCAGCAAGAAATCGCTGTTGATATGGG
CCTATGCTATAGGATGCTTTGATCTGATCAGCGCATTGCTTTTTTCCATG
GTCAGTTTGAAGACAATTTGCGAACACCTAAGTTGGCTAACAATTTTTGC
CGCTATTTTTGGCCTCTTTTGGATAACAATGATTGTGATGCTGCTGGTTG
GCATTCATGGGCGCCATCCTAGTTGTGTTCGTGCCTGGATTATCTTCTCC
TGCGTGGGAATCATGGTCGAGATGTGCCTGGTGTTGTATGCCGTTTTCAA
CGAGAGCTCCTTCCAAATGGGTCTGGTCAAAAATGGACTATTACTCATGG
TGGGATTGATTGTGGAGTGCATTTTTCTATACATCGTTCAACGGTTCTAC
GTGACTTTGGCCTTTTGCCAAGCCTGTCATAAGGCTATAGCCACAAAAAT
AGCACAACAGGAAGCTTGTATGGATTATGAAAGAGAACACAGTCACCAAA
GGCATCATTTTAATTATGGCGAAACCAAAAGACCTATTCAAAACCAAAAT
AGCAGGGGAAAAATAGTTAAAAACTCTCCGTCACAACCAATGAAGATGGG
TTTTTTCAGACCTTCAGACAGCAGCTCAACAACGTAAAATGAAGGGTTAT
ATATATTTATTTTATAGCTAAAATATTAAAAGACAAGTTTGTAAAAATAT
TAAAAAAAAAAAAAAAAAAAAAA

IP16890.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34238.a 754 CG34238.a 54..754 1..701 3505 100 Plus
CG34238-RA 754 CG34238-RA 54..754 1..701 3505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10618477..10618820 360..701 1640 99.1 Plus
chr3L 24539361 chr3L 10618273..10618421 211..359 715 98.7 Plus
chr3L 24539361 chr3L 10617930..10618061 1..132 645 99.2 Plus
chr3L 24539361 chr3L 10618124..10618207 128..211 420 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10627098..10627444 360..706 1735 100 Plus
3L 28110227 3L 10626894..10627042 211..359 745 100 Plus
3L 28110227 3L 10626552..10626683 1..132 645 99.2 Plus
3L 28110227 3L 10626746..10626829 128..211 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10620198..10620544 360..706 1735 100 Plus
3L 28103327 3L 10619994..10620142 211..359 745 100 Plus
3L 28103327 3L 10619652..10619783 1..132 645 99.2 Plus
3L 28103327 3L 10619846..10619929 128..211 420 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:29:13 has no hits.

IP16890.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:30:00 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10617930..10618056 1..127 100 -> Plus
chr3L 10618124..10618207 128..211 100 -> Plus
chr3L 10618274..10618421 212..359 98 -> Plus
chr3L 10618477..10618763 360..646 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:04:35 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 1..621 17..637 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:18:27 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 1..621 17..637 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:27:54 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 1..621 17..637 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:31:59 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 1..621 17..637 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:23 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 1..621 17..637 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:46:42 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 1..701 1..701 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:18:27 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 1..701 1..701 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:27:54 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 54..754 1..701 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:31:59 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 1..701 1..701 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:23 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
CG34238-RA 54..754 1..701 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:00 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10626552..10626678 1..127 100 -> Plus
3L 10626746..10626829 128..211 100 -> Plus
3L 10626895..10627042 212..359 100 -> Plus
3L 10627098..10627439 360..701 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:00 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10626552..10626678 1..127 100 -> Plus
3L 10626746..10626829 128..211 100 -> Plus
3L 10626895..10627042 212..359 100 -> Plus
3L 10627098..10627439 360..701 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:30:00 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10626552..10626678 1..127 100 -> Plus
3L 10626746..10626829 128..211 100 -> Plus
3L 10626895..10627042 212..359 100 -> Plus
3L 10627098..10627439 360..701 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:27:54 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10619652..10619778 1..127 100 -> Plus
arm_3L 10619846..10619929 128..211 100 -> Plus
arm_3L 10619995..10620142 212..359 100 -> Plus
arm_3L 10620198..10620539 360..701 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:07 Download gff for IP16890.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10619652..10619778 1..127 100 -> Plus
3L 10619846..10619929 128..211 100 -> Plus
3L 10619995..10620142 212..359 100 -> Plus
3L 10620198..10620539 360..701 100   Plus

IP16890.hyp Sequence

Translation from 0 to 636

> IP16890.hyp
FSFFDMISSKKSLLIWAYAIGCFDLISALLFSMVSLKTICEHLSWLTIFA
AIFGLFWITMIVMLLVGIHGRHPSCVRAWIIFSCVGIMVEMCLVLYAVFN
ESSFQMGLVKNGLLLMVGLIVECIFLYIVQRFYVTLAFCQACHKAIATKI
AQQEACMDYEREHSHQRHHFNYGETKRPIQNQNSRGKIVKNSPSQPMKMG
FFRPSDSSSTT*

IP16890.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34238-PA 206 CG34238-PA 1..206 6..211 1084 100 Plus
CG14151-PA 196 CG14151-PA 13..152 17..156 229 34.3 Plus
CG42535-PA 187 CG42535-PA 39..154 18..133 186 27.6 Plus
CG42536-PA 184 CG42536-PA 14..135 12..133 154 26.2 Plus

IP16890.pep Sequence

Translation from 1 to 636

> IP16890.pep
FSFFDMISSKKSLLIWAYAIGCFDLISALLFSMVSLKTICEHLSWLTIFA
AIFGLFWITMIVMLLVGIHGRHPSCVRAWIIFSCVGIMVEMCLVLYAVFN
ESSFQMGLVKNGLLLMVGLIVECIFLYIVQRFYVTLAFCQACHKAIATKI
AQQEACMDYEREHSHQRHHFNYGETKRPIQNQNSRGKIVKNSPSQPMKMG
FFRPSDSSSTT*

IP16890.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23826-PA 199 GF23826-PA 13..197 17..200 194 32.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15439-PA 206 GG15439-PA 2..206 1..211 858 80.6 Plus
Dere\GG13969-PA 197 GG13969-PA 13..152 17..156 218 34.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16545-PA 196 GH16545-PA 4..132 8..136 216 43.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG34238-PA 206 CG34238-PA 1..206 6..211 1084 100 Plus
CG14151-PA 196 CG14151-PA 13..152 17..156 229 34.3 Plus
CG42535-PA 187 CG42535-PA 39..154 18..133 186 27.6 Plus
CG42536-PA 184 CG42536-PA 14..135 12..133 154 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13834-PA 407 GI13834-PA 191..371 6..195 333 38.4 Plus
Dmoj\GI13834-PA 407 GI13834-PA 2..128 10..136 197 37 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15470-PA 104 GL15470-PA 2..100 23..149 257 44.1 Plus
Dper\GL15592-PA 134 GL15592-PA 1..122 6..125 136 36.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23832-PA 104 GA23832-PA 2..100 23..149 257 44.1 Plus
Dpse\GA23456-PA 203 GA23456-PA 1..198 6..187 178 29.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24805-PA 196 GM24805-PA 13..195 17..198 226 29 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14246-PA 178 GD14246-PA 1..178 6..211 819 75.2 Plus
Dsim\GD12858-PA 196 GD12858-PA 13..195 17..198 225 28.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11701-PA 410 GJ11701-PA 202..335 9..144 339 51.5 Plus
Dvir\GJ11701-PA 410 GJ11701-PA 4..132 8..136 186 37.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12361-PA 195 GK12361-PA 10..180 17..187 231 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20268-PA 200 GE20268-PA 13..152 17..156 202 32.9 Plus