BDGP Sequence Production Resources |
Search the DGRC for IP16890
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 168 |
Well: | 90 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34238-RA |
Protein status: | IP16890.pep: gold |
Sequenced Size: | 723 |
Gene | Date | Evidence |
---|---|---|
CG34238 | 2008-04-29 | Release 5.5 accounting |
CG34238 | 2008-08-15 | Release 5.9 accounting |
CG34238 | 2008-12-18 | 5.12 accounting |
723 bp assembled on 2006-11-28
GenBank Submission: BT029572
> IP16890.complete GTTTTCATTTTTCGATATGATCTCCAGCAAGAAATCGCTGTTGATATGGG CCTATGCTATAGGATGCTTTGATCTGATCAGCGCATTGCTTTTTTCCATG GTCAGTTTGAAGACAATTTGCGAACACCTAAGTTGGCTAACAATTTTTGC CGCTATTTTTGGCCTCTTTTGGATAACAATGATTGTGATGCTGCTGGTTG GCATTCATGGGCGCCATCCTAGTTGTGTTCGTGCCTGGATTATCTTCTCC TGCGTGGGAATCATGGTCGAGATGTGCCTGGTGTTGTATGCCGTTTTCAA CGAGAGCTCCTTCCAAATGGGTCTGGTCAAAAATGGACTATTACTCATGG TGGGATTGATTGTGGAGTGCATTTTTCTATACATCGTTCAACGGTTCTAC GTGACTTTGGCCTTTTGCCAAGCCTGTCATAAGGCTATAGCCACAAAAAT AGCACAACAGGAAGCTTGTATGGATTATGAAAGAGAACACAGTCACCAAA GGCATCATTTTAATTATGGCGAAACCAAAAGACCTATTCAAAACCAAAAT AGCAGGGGAAAAATAGTTAAAAACTCTCCGTCACAACCAATGAAGATGGG TTTTTTCAGACCTTCAGACAGCAGCTCAACAACGTAAAATGAAGGGTTAT ATATATTTATTTTATAGCTAAAATATTAAAAGACAAGTTTGTAAAAATAT TAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 10618477..10618820 | 360..701 | 1640 | 99.1 | Plus |
chr3L | 24539361 | chr3L | 10618273..10618421 | 211..359 | 715 | 98.7 | Plus |
chr3L | 24539361 | chr3L | 10617930..10618061 | 1..132 | 645 | 99.2 | Plus |
chr3L | 24539361 | chr3L | 10618124..10618207 | 128..211 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 10627098..10627444 | 360..706 | 1735 | 100 | Plus |
3L | 28110227 | 3L | 10626894..10627042 | 211..359 | 745 | 100 | Plus |
3L | 28110227 | 3L | 10626552..10626683 | 1..132 | 645 | 99.2 | Plus |
3L | 28110227 | 3L | 10626746..10626829 | 128..211 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 10620198..10620544 | 360..706 | 1735 | 100 | Plus |
3L | 28103327 | 3L | 10619994..10620142 | 211..359 | 745 | 100 | Plus |
3L | 28103327 | 3L | 10619652..10619783 | 1..132 | 645 | 99.2 | Plus |
3L | 28103327 | 3L | 10619846..10619929 | 128..211 | 420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 10617930..10618056 | 1..127 | 100 | -> | Plus |
chr3L | 10618124..10618207 | 128..211 | 100 | -> | Plus |
chr3L | 10618274..10618421 | 212..359 | 98 | -> | Plus |
chr3L | 10618477..10618763 | 360..646 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 1..621 | 17..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 1..621 | 17..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 1..621 | 17..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 1..621 | 17..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 1..621 | 17..637 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 1..701 | 1..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 1..701 | 1..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 54..754 | 1..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 1..701 | 1..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34238-RA | 54..754 | 1..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10626552..10626678 | 1..127 | 100 | -> | Plus |
3L | 10626746..10626829 | 128..211 | 100 | -> | Plus |
3L | 10626895..10627042 | 212..359 | 100 | -> | Plus |
3L | 10627098..10627439 | 360..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10626552..10626678 | 1..127 | 100 | -> | Plus |
3L | 10626746..10626829 | 128..211 | 100 | -> | Plus |
3L | 10626895..10627042 | 212..359 | 100 | -> | Plus |
3L | 10627098..10627439 | 360..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10626552..10626678 | 1..127 | 100 | -> | Plus |
3L | 10626746..10626829 | 128..211 | 100 | -> | Plus |
3L | 10626895..10627042 | 212..359 | 100 | -> | Plus |
3L | 10627098..10627439 | 360..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 10619652..10619778 | 1..127 | 100 | -> | Plus |
arm_3L | 10619846..10619929 | 128..211 | 100 | -> | Plus |
arm_3L | 10619995..10620142 | 212..359 | 100 | -> | Plus |
arm_3L | 10620198..10620539 | 360..701 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 10619652..10619778 | 1..127 | 100 | -> | Plus |
3L | 10619846..10619929 | 128..211 | 100 | -> | Plus |
3L | 10619995..10620142 | 212..359 | 100 | -> | Plus |
3L | 10620198..10620539 | 360..701 | 100 | Plus |
Translation from 0 to 636
> IP16890.hyp FSFFDMISSKKSLLIWAYAIGCFDLISALLFSMVSLKTICEHLSWLTIFA AIFGLFWITMIVMLLVGIHGRHPSCVRAWIIFSCVGIMVEMCLVLYAVFN ESSFQMGLVKNGLLLMVGLIVECIFLYIVQRFYVTLAFCQACHKAIATKI AQQEACMDYEREHSHQRHHFNYGETKRPIQNQNSRGKIVKNSPSQPMKMG FFRPSDSSSTT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34238-PA | 206 | CG34238-PA | 1..206 | 6..211 | 1084 | 100 | Plus |
CG14151-PA | 196 | CG14151-PA | 13..152 | 17..156 | 229 | 34.3 | Plus |
CG42535-PA | 187 | CG42535-PA | 39..154 | 18..133 | 186 | 27.6 | Plus |
CG42536-PA | 184 | CG42536-PA | 14..135 | 12..133 | 154 | 26.2 | Plus |
Translation from 1 to 636
> IP16890.pep FSFFDMISSKKSLLIWAYAIGCFDLISALLFSMVSLKTICEHLSWLTIFA AIFGLFWITMIVMLLVGIHGRHPSCVRAWIIFSCVGIMVEMCLVLYAVFN ESSFQMGLVKNGLLLMVGLIVECIFLYIVQRFYVTLAFCQACHKAIATKI AQQEACMDYEREHSHQRHHFNYGETKRPIQNQNSRGKIVKNSPSQPMKMG FFRPSDSSSTT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23826-PA | 199 | GF23826-PA | 13..197 | 17..200 | 194 | 32.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15439-PA | 206 | GG15439-PA | 2..206 | 1..211 | 858 | 80.6 | Plus |
Dere\GG13969-PA | 197 | GG13969-PA | 13..152 | 17..156 | 218 | 34.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16545-PA | 196 | GH16545-PA | 4..132 | 8..136 | 216 | 43.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34238-PA | 206 | CG34238-PA | 1..206 | 6..211 | 1084 | 100 | Plus |
CG14151-PA | 196 | CG14151-PA | 13..152 | 17..156 | 229 | 34.3 | Plus |
CG42535-PA | 187 | CG42535-PA | 39..154 | 18..133 | 186 | 27.6 | Plus |
CG42536-PA | 184 | CG42536-PA | 14..135 | 12..133 | 154 | 26.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13834-PA | 407 | GI13834-PA | 191..371 | 6..195 | 333 | 38.4 | Plus |
Dmoj\GI13834-PA | 407 | GI13834-PA | 2..128 | 10..136 | 197 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15470-PA | 104 | GL15470-PA | 2..100 | 23..149 | 257 | 44.1 | Plus |
Dper\GL15592-PA | 134 | GL15592-PA | 1..122 | 6..125 | 136 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23832-PA | 104 | GA23832-PA | 2..100 | 23..149 | 257 | 44.1 | Plus |
Dpse\GA23456-PA | 203 | GA23456-PA | 1..198 | 6..187 | 178 | 29.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24805-PA | 196 | GM24805-PA | 13..195 | 17..198 | 226 | 29 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14246-PA | 178 | GD14246-PA | 1..178 | 6..211 | 819 | 75.2 | Plus |
Dsim\GD12858-PA | 196 | GD12858-PA | 13..195 | 17..198 | 225 | 28.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11701-PA | 410 | GJ11701-PA | 202..335 | 9..144 | 339 | 51.5 | Plus |
Dvir\GJ11701-PA | 410 | GJ11701-PA | 4..132 | 8..136 | 186 | 37.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12361-PA | 195 | GK12361-PA | 10..180 | 17..187 | 231 | 33.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20268-PA | 200 | GE20268-PA | 13..152 | 17..156 | 202 | 32.9 | Plus |