Clone IP16896 Report

Search the DGRC for IP16896

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:168
Well:96
Vector:pOT2
Associated Gene/TranscriptCG34244-RA
Protein status:IP16896.pep: gold
Sequenced Size:499

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34244 2008-04-29 Release 5.5 accounting
CG34244 2008-08-15 Release 5.9 accounting
CG34244 2008-12-18 5.12 accounting

Clone Sequence Records

IP16896.complete Sequence

499 bp assembled on 2006-11-28

GenBank Submission: BT029575

> IP16896.complete
TTGCTGCGAACACAGCAAGGTAATACGCATCAAAAATAAAGAACAACAGT
TTCGACCGAAGGACCTCATCATAAACCAACCATGAAGCTCCTGTCTTTAT
TCCTTCTGGCTTACATCGCTTATACTGCCGCTAAAGTGGTTCCCGCTTCA
AACAGCAATAGCCTGAGCATTGACCAGCACGGCAAAAGGGTTTATGCGGA
TGTGACCGAGGATAATTGCGACTATTCTTGTCCCGAAAAGGATCCTTCGG
TCTGTGCCACCAATGGACAATGCATTCTGAAGTTTGAGAGCCGCTGTGCC
ATGTCAGCCTACAACTGCCGTAATCCCCAGAAAATGTTTAAACCCGTGGA
AGACCATCGTTGCACGCAGGACTGGCAGCCTCTTTGCATGGAGTCAGATC
TCAGGGAGTTCGGCTTGTGAGAAATGTTCATCAGTTGAAAGGTTGAGCAG
AAAAATAAAATGAAAATTACGAAAATTTTAAAAAAAAAAAAAAAAAAAA

IP16896.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34244-RA 830 CG34244-RA 222..699 1..478 2390 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14225291..14225660 478..109 1805 99.2 Minus
chr3L 24539361 chr3L 14225720..14225828 109..1 545 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14235183..14235552 478..109 1850 100 Minus
3L 28110227 3L 14235612..14235720 109..1 545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14228283..14228652 478..109 1850 100 Minus
3L 28103327 3L 14228712..14228820 109..1 545 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:22:42 has no hits.

IP16896.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:23:29 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14225289..14225659 110..479 98 <- Minus
chr3L 14225720..14225828 1..109 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:04:40 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..339 82..420 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:18:31 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..339 82..420 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:27:42 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..339 82..420 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:32:07 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..339 82..420 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:26 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..339 82..420 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:46:45 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..478 1..478 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:18:31 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..478 1..478 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:27:42 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..478 1..478 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:32:08 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..478 1..478 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:26 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
CG34244-RA 1..478 1..478 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:29 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14235181..14235551 110..479 99 <- Minus
3L 14235612..14235720 1..109 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:29 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14235181..14235551 110..479 99 <- Minus
3L 14235612..14235720 1..109 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:29 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14235181..14235551 110..479 99 <- Minus
3L 14235612..14235720 1..109 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:27:42 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14228281..14228651 110..479 99 <- Minus
arm_3L 14228712..14228820 1..109 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:10 Download gff for IP16896.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14228281..14228651 110..479 99 <- Minus
3L 14228712..14228820 1..109 100   Minus

IP16896.hyp Sequence

Translation from 81 to 419

> IP16896.hyp
MKLLSLFLLAYIAYTAAKVVPASNSNSLSIDQHGKRVYADVTEDNCDYSC
PEKDPSVCATNGQCILKFESRCAMSAYNCRNPQKMFKPVEDHRCTQDWQP
LCMESDLREFGL*

IP16896.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34244-PB 112 CG34244-PB 1..112 1..112 609 100 Plus
CG34244-PA 112 CG34244-PA 1..112 1..112 609 100 Plus

IP16896.pep Sequence

Translation from 81 to 419

> IP16896.pep
MKLLSLFLLAYIAYTAAKVVPASNSNSLSIDQHGKRVYADVTEDNCDYSC
PEKDPSVCATNGQCILKFESRCAMSAYNCRNPQKMFKPVEDHRCTQDWQP
LCMESDLREFGL*

IP16896.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25202-PA 112 GF25202-PA 1..112 1..112 450 71.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13731-PA 112 GG13731-PA 1..112 1..112 547 88.4 Plus
Dere\GG15681-PA 350 GG15681-PA 258..338 19..94 137 32.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34244-PB 112 CG34244-PB 1..112 1..112 609 100 Plus
CG34244-PA 112 CG34244-PA 1..112 1..112 609 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13604-PA 119 GI13604-PA 5..117 3..112 276 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20994-PA 106 GL20994-PA 1..106 1..112 386 64.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23489-PA 106 GA23489-PA 1..106 1..112 386 64.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24552-PA 112 GM24552-PA 1..112 1..112 578 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12625-PA 116 GD12625-PA 16..116 12..112 524 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13941-PA 118 GJ13941-PA 19..116 19..112 262 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10353-PA 119 GK10353-PA 6..118 3..112 253 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20025-PA 112 GE20025-PA 1..112 1..112 554 90.2 Plus