Clone IP16901 Report

Search the DGRC for IP16901

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:169
Well:1
Vector:pOT2
Associated Gene/TranscriptCG34161-RA
Protein status:IP16901.pep: gold
Sequenced Size:541

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34161 2008-04-29 Release 5.5 accounting
CG34161 2008-08-15 Release 5.9 accounting
CG34161 2008-12-18 5.12 accounting

Clone Sequence Records

IP16901.complete Sequence

541 bp assembled on 2006-11-28

GenBank Submission: BT029576

> IP16901.complete
AAAGTATAAGAAATTTCTTTAAAAATGAGCAGTCAAATTAAAAAGTCCAA
AACGACCACCAAGAAATTGGTGAAATCATCTCCGAAAGCTCAACTTCCAA
AAGCTGCGGCACAGAATCAAATTTTTAGTTGCCAATTCGAGGTGTTTGGT
CATGTGCAAGGTGTCTTCTTTCGCAAGCACACTCAAAAAAAGGCCATTGA
GCTGGGCATAACTGGCTGGTGCATGAACACAACTCAAGGAACGGTTCAGG
GAATGCTCGAAGGATCCTTGGACCAAATGACTGATATGAAATACTGGCTG
CAGCACAAGGGAAGTCCTCGTTCGGTGATCGAAAAGGCTGTATTCTCCGA
GAATGAACCACTGCCCATCAACAACTTTAAGATGTTCTCGATTCGTCGCT
AGGGATTATTTTACGCCAAAATTCATTTATTAATTTTATAAAGTTGAAAT
TAAGATGTGACTCGAGCTGAAACGTGAGAATCGCTTTGAGCACGCAATAT
ATACATATGTATGTGCTTCTAAAAAAAAAAAAAAAAAAAAA

IP16901.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34161-RA 672 CG34161-RA 77..597 1..521 2605 100 Plus
CG34161-RC 672 CG34161-RC 77..597 1..521 2605 100 Plus
CG34161-RB 512 CG34161-RB 175..506 190..521 1660 100 Plus
CG34161-RB 512 CG34161-RB 1..177 1..177 885 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10579781..10580013 520..288 1165 100 Minus
chr2L 23010047 chr2L 10580308..10580469 162..1 810 100 Minus
chr2L 23010047 chr2L 10580068..10580180 288..176 565 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10580972..10581205 521..288 1170 100 Minus
2L 23513712 2L 10581500..10581661 162..1 810 100 Minus
2L 23513712 2L 10581260..10581372 288..176 565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10580972..10581205 521..288 1170 100 Minus
2L 23513712 2L 10581500..10581661 162..1 810 100 Minus
2L 23513712 2L 10581260..10581372 288..176 565 100 Minus
Blast to na_te.dros performed 2019-03-16 06:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy2 6841 gypsy2 GYPSY2 6841bp 5487..5558 9..80 108 61.1 Plus

IP16901.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:02:31 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10580310..10580469 1..160 100   Minus
chr2L 10579781..10580013 288..520 100 <- Minus
chr2L 10580069..10580178 178..287 100 <- Minus
chr2L 10580232..10580248 161..177 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:04:42 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..378 25..402 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:24 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RC 1..378 25..402 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:14:31 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..378 25..402 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:54 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..378 25..402 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:13:07 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..378 25..402 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:58 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..520 1..520 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:24 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RC 2..521 1..520 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:14:31 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 42..561 1..520 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:55 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 1..520 1..520 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:13:07 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
CG34161-RA 42..561 1..520 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:31 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10580973..10581205 288..520 100 <- Minus
2L 10581261..10581370 178..287 100 <- Minus
2L 10581424..10581440 161..177 100 <- Minus
2L 10581502..10581661 1..160 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:31 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10580973..10581205 288..520 100 <- Minus
2L 10581261..10581370 178..287 100 <- Minus
2L 10581424..10581440 161..177 100 <- Minus
2L 10581502..10581661 1..160 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:31 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10580973..10581205 288..520 100 <- Minus
2L 10581261..10581370 178..287 100 <- Minus
2L 10581424..10581440 161..177 100 <- Minus
2L 10581502..10581661 1..160 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:14:31 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10580973..10581205 288..520 100 <- Minus
arm_2L 10581261..10581370 178..287 100 <- Minus
arm_2L 10581424..10581440 161..177 100 <- Minus
arm_2L 10581502..10581661 1..160 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:44 Download gff for IP16901.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10580973..10581205 288..520 100 <- Minus
2L 10581261..10581370 178..287 100 <- Minus
2L 10581424..10581440 161..177 100 <- Minus
2L 10581502..10581661 1..160 100   Minus

IP16901.hyp Sequence

Translation from 24 to 401

> IP16901.hyp
MSSQIKKSKTTTKKLVKSSPKAQLPKAAAQNQIFSCQFEVFGHVQGVFFR
KHTQKKAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQHKGSPRS
VIEKAVFSENEPLPINNFKMFSIRR*

IP16901.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34161-PC 125 CG34161-PC 1..125 1..125 651 100 Plus
CG34161-PA 125 CG34161-PA 1..125 1..125 651 100 Plus
CG34161-PB 120 CG34161-PB 1..120 1..125 607 96 Plus
CG18371-PA 110 CG18371-PA 7..99 32..124 250 51.6 Plus
Acyp2-PB 102 CG18505-PB 9..101 32..124 245 47.3 Plus

IP16901.pep Sequence

Translation from 24 to 401

> IP16901.pep
MSSQIKKSKTTTKKLVKSSPKAQLPKAAAQNQIFSCQFEVFGHVQGVFFR
KHTQKKAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQHKGSPRS
VIEKAVFSENEPLPINNFKMFSIRR*

IP16901.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:19:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14085-PA 119 GF14085-PA 1..119 1..125 490 74.4 Plus
Dana\GF18541-PA 102 GF18541-PA 4..102 27..125 317 56.6 Plus
Dana\GF19668-PA 116 GF19668-PA 2..97 29..124 260 50 Plus
Dana\GF12022-PA 108 GF12022-PA 7..99 32..124 249 48.4 Plus
Dana\GF16871-PA 150 GF16871-PA 57..148 33..121 245 48.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10375-PA 124 GG10375-PA 1..124 1..125 557 92 Plus
Dere\GG16952-PA 102 GG16952-PA 9..102 32..125 280 54.3 Plus
Dere\GG20418-PA 107 GG20418-PA 5..98 31..124 258 51.1 Plus
Dere\GG24762-PA 149 GG24762-PA 25..146 2..123 248 41 Plus
Dere\GG23897-PA 119 GG23897-PA 2..97 28..124 238 50.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11746-PA 124 GH11746-PA 31..124 32..125 346 60.6 Plus
Dgri\GH11331-PA 99 GH11331-PA 6..99 32..125 343 60.6 Plus
Dgri\GH18239-PA 96 GH18239-PA 4..96 33..125 294 57 Plus
Dgri\GH22670-PA 111 GH22670-PA 6..102 28..124 253 46.4 Plus
Dgri\GH15191-PA 141 GH15191-PA 13..135 3..123 232 40.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34161-PC 125 CG34161-PC 1..125 1..125 651 100 Plus
CG34161-PA 125 CG34161-PA 1..125 1..125 651 100 Plus
CG34161-PB 120 CG34161-PB 1..120 1..125 607 96 Plus
CG18371-PA 110 CG18371-PA 7..99 32..124 250 51.6 Plus
Acyp2-PB 102 CG18505-PB 9..101 32..124 245 47.3 Plus
Acyp2-PA 102 CG18505-PA 9..101 32..124 245 47.3 Plus
CG11052-PD 149 CG11052-PD 29..146 6..123 243 39.8 Plus
CG11052-PC 149 CG11052-PC 29..146 6..123 243 39.8 Plus
CG11052-PB 149 CG11052-PB 29..146 6..123 243 39.8 Plus
CG11052-PA 149 CG11052-PA 29..146 6..123 243 39.8 Plus
Acyp-PB 120 CG16870-PB 2..97 29..124 234 47.9 Plus
Acyp-PA 120 CG16870-PA 2..97 29..124 234 47.9 Plus
CG14022-PB 101 CG14022-PB 9..100 33..124 168 35.9 Plus
CG14022-PA 101 CG14022-PA 9..100 33..124 168 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17837-PA 99 GI17837-PA 3..99 29..125 345 59.8 Plus
Dmoj\GI10195-PA 96 GI10195-PA 3..96 32..125 290 56.4 Plus
Dmoj\GI22288-PA 120 GI22288-PA 4..95 33..124 259 53.3 Plus
Dmoj\GI21180-PA 110 GI21180-PA 4..99 29..124 252 47.9 Plus
Dmoj\GI10542-PA 101 GI10542-PA 8..100 32..124 180 37.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26404-PA 132 GL26404-PA 1..116 1..124 368 58.1 Plus
Dper\GL22235-PA 102 GL22235-PA 1..102 24..125 313 53.9 Plus
Dper\GL16721-PA 110 GL16721-PA 4..99 29..124 256 47.9 Plus
Dper\GL22340-PA 143 GL22340-PA 28..141 11..124 256 43 Plus
Dper\GL21249-PA 116 GL21249-PA 4..97 31..124 246 46.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28850-PA 117 GA28850-PA 1..117 1..125 374 58.4 Plus
Dpse\GA27428-PA 102 GA27428-PA 1..102 24..125 313 53.9 Plus
Dpse\GA14909-PA 110 GA14909-PA 4..99 29..124 254 47.9 Plus
Dpse\GA28779-PA 116 GA28779-PA 4..97 31..124 246 46.8 Plus
Dpse\GA27462-PB 128 GA27462-PB 28..126 11..124 189 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11586-PA 124 GM11586-PA 1..124 1..125 560 92 Plus
Dsec\GM21504-PA 110 GM21504-PA 7..99 32..124 256 51.6 Plus
Dsec\GM24259-PA 102 GM24259-PA 4..102 27..125 254 49.5 Plus
Dsec\GM10438-PA 149 GM10438-PA 52..146 29..123 244 46.3 Plus
Dsec\GM15374-PA 120 GM15374-PA 2..97 29..124 239 47.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22242-PA 124 GD22242-PA 1..124 1..125 556 91.2 Plus
Dsim\GD10999-PA 110 GD10999-PA 7..99 32..124 256 51.6 Plus
Dsim\GD19440-PA 149 GD19440-PA 52..146 29..123 240 46.3 Plus
Dsim\Acyp-PA 120 GD23938-PA 2..97 29..124 239 47.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17330-PA 99 GJ17330-PA 2..99 28..125 360 61.2 Plus
Dvir\GJ24080-PA 122 GJ24080-PA 4..95 33..124 265 53.3 Plus
Dvir\GJ23483-PA 96 GJ23483-PA 4..95 33..124 260 55.4 Plus
Dvir\GJ21038-PA 111 GJ21038-PA 5..99 30..124 256 48.4 Plus
Dvir\GJ21758-PA 101 GJ21758-PA 8..100 32..124 179 37.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15522-PA 126 GK15522-PA 18..126 15..125 401 66.7 Plus
Dwil\GK12388-PA 99 GK12388-PA 2..98 28..124 274 54.6 Plus
Dwil\GK19418-PA 107 GK19418-PA 6..99 31..124 259 48.9 Plus
Dwil\GK14028-PA 139 GK14028-PA 46..137 33..124 237 46.7 Plus
Dwil\GK18433-PA 101 GK18433-PA 8..100 32..124 184 37.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13517-PA 124 GE13517-PA 1..124 1..125 575 95.2 Plus
Dyak\GE24338-PA 102 GE24338-PA 9..102 32..125 284 54.3 Plus
Dyak\GE12579-PA 110 GE12579-PA 6..99 31..124 256 50 Plus
Dyak\GE19011-PA 120 GE19011-PA 2..97 28..124 236 49.5 Plus
Dyak\GE25751-PA 149 GE25751-PA 29..146 6..123 234 38.1 Plus