Clone IP16915 Report

Search the DGRC for IP16915

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:169
Well:15
Vector:pOT2
Associated Gene/TranscriptCG34172-RA
Protein status:IP16915.pep: gold
Sequenced Size:315

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34172 2008-04-29 Release 5.5 accounting
CG34172 2008-08-15 Release 5.9 accounting
CG34172 2008-12-18 5.12 accounting

Clone Sequence Records

IP16915.complete Sequence

315 bp assembled on 2006-11-28

GenBank Submission: BT029580

> IP16915.complete
AAAGTGCAGCAAGTCAATTGCAATTCGCTAATTGAGCAGTTACATAAGAG
ACCTAGGCAAAAATGGCTCTACCCGATGGACTTTCCAACAAAATGAAGGT
TTTCCAGGCCGTTAACGAGCTGCCCGTTTTTCTGAAAGGCGGACCTGCGG
ATAAGATTTTATTTGGCATTACGGCTGGACTGTGTGGCCTTGGCATTGTT
AGCTTTGTCCACCTGGTCTACACAATGGGATTCGCCAAAAAGAAGGCCTA
AGTTATGTGTTTAAATACTTTTTCGATTAAAGAGAAACTAATGTAATTAA
AAAAAAAAAAAAAAA

IP16915.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-RA 366 CG34172-RA 62..362 1..301 1505 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2192275..2192473 298..100 980 99.5 Minus
chr2L 23010047 chr2L 2192527..2192604 108..31 375 98.7 Minus
chr2L 23010047 chr2L 2192725..2192760 36..1 180 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:28:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2192522..2192723 301..100 995 99.5 Minus
2L 23513712 2L 2192777..2192854 108..31 375 98.7 Minus
2L 23513712 2L 2192975..2193010 36..1 180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2192522..2192723 301..100 995 99.5 Minus
2L 23513712 2L 2192777..2192854 108..31 375 98.7 Minus
2L 23513712 2L 2192975..2193010 36..1 180 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:01:16 has no hits.

IP16915.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:02:09 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2192275..2192465 108..298 100 <- Minus
chr2L 2192528..2192598 37..107 100 <- Minus
chr2L 2192725..2192760 1..36 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:04:46 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 1..189 63..251 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:01:28 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 1..189 63..251 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:09 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RB 1..189 63..251 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:01 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 1..189 63..251 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:58:50 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RB 1..189 63..251 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:26:30 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 1..298 1..298 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:01:28 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 1..298 1..298 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:09 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 1..298 1..298 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:02 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 1..298 1..298 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:58:50 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 1..298 1..298 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:09 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2192525..2192715 108..298 100 <- Minus
2L 2192778..2192848 37..107 100 <- Minus
2L 2192975..2193010 1..36 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:09 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2192525..2192715 108..298 100 <- Minus
2L 2192778..2192848 37..107 100 <- Minus
2L 2192975..2193010 1..36 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:09 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2192525..2192715 108..298 100 <- Minus
2L 2192778..2192848 37..107 100 <- Minus
2L 2192975..2193010 1..36 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:09 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2192525..2192715 108..298 100 <- Minus
arm_2L 2192778..2192848 37..107 100 <- Minus
arm_2L 2192975..2193010 1..36 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:26 Download gff for IP16915.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2192525..2192715 108..298 100 <- Minus
2L 2192778..2192848 37..107 100 <- Minus
2L 2192975..2193010 1..36 100   Minus

IP16915.hyp Sequence

Translation from 62 to 250

> IP16915.hyp
MALPDGLSNKMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVH
LVYTMGFAKKKA*

IP16915.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-PD 62 CG34172-PD 1..62 1..62 317 100 Plus
CG34172-PC 62 CG34172-PC 1..62 1..62 317 100 Plus
CG34172-PB 62 CG34172-PB 1..62 1..62 317 100 Plus
CG34172-PA 62 CG34172-PA 1..62 1..62 317 100 Plus

IP16915.pep Sequence

Translation from 62 to 250

> IP16915.pep
MALPDGLSNKMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVH
LVYTMGFAKKKA*

IP16915.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15302-PA 62 GF15302-PA 1..62 1..62 299 91.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24551-PA 62 GG24551-PA 1..62 1..62 307 96.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11473-PA 297 GH11473-PA 248..297 13..62 209 72 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-PD 62 CG34172-PD 1..62 1..62 317 100 Plus
CG34172-PC 62 CG34172-PC 1..62 1..62 317 100 Plus
CG34172-PB 62 CG34172-PB 1..62 1..62 317 100 Plus
CG34172-PA 62 CG34172-PA 1..62 1..62 317 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16950-PA 62 GI16950-PA 1..62 1..62 258 75.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19418-PA 62 GL19418-PA 1..62 1..62 277 83.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25953-PA 62 GA25953-PA 1..62 1..62 277 83.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18260-PA 62 GM18260-PA 1..62 1..62 311 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22869-PA 62 GD22869-PA 1..62 1..62 311 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17215-PA 73 GJ17215-PA 26..73 15..62 204 79.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15137-PA 62 GK15137-PA 1..62 1..62 300 95.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15214-PA 62 GE15214-PA 1..62 1..62 306 96.8 Plus