BDGP Sequence Production Resources |
Search the DGRC for IP16915
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 169 |
Well: | 15 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34172-RA |
Protein status: | IP16915.pep: gold |
Sequenced Size: | 315 |
Gene | Date | Evidence |
---|---|---|
CG34172 | 2008-04-29 | Release 5.5 accounting |
CG34172 | 2008-08-15 | Release 5.9 accounting |
CG34172 | 2008-12-18 | 5.12 accounting |
315 bp assembled on 2006-11-28
GenBank Submission: BT029580
> IP16915.complete AAAGTGCAGCAAGTCAATTGCAATTCGCTAATTGAGCAGTTACATAAGAG ACCTAGGCAAAAATGGCTCTACCCGATGGACTTTCCAACAAAATGAAGGT TTTCCAGGCCGTTAACGAGCTGCCCGTTTTTCTGAAAGGCGGACCTGCGG ATAAGATTTTATTTGGCATTACGGCTGGACTGTGTGGCCTTGGCATTGTT AGCTTTGTCCACCTGGTCTACACAATGGGATTCGCCAAAAAGAAGGCCTA AGTTATGTGTTTAAATACTTTTTCGATTAAAGAGAAACTAATGTAATTAA AAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34172-RA | 366 | CG34172-RA | 62..362 | 1..301 | 1505 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 2192275..2192473 | 298..100 | 980 | 99.5 | Minus |
chr2L | 23010047 | chr2L | 2192527..2192604 | 108..31 | 375 | 98.7 | Minus |
chr2L | 23010047 | chr2L | 2192725..2192760 | 36..1 | 180 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 2192275..2192465 | 108..298 | 100 | <- | Minus |
chr2L | 2192528..2192598 | 37..107 | 100 | <- | Minus |
chr2L | 2192725..2192760 | 1..36 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RA | 1..189 | 63..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RA | 1..189 | 63..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RB | 1..189 | 63..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RA | 1..189 | 63..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RB | 1..189 | 63..251 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RA | 1..298 | 1..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RA | 1..298 | 1..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RA | 1..298 | 1..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RA | 1..298 | 1..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34172-RA | 1..298 | 1..298 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2192525..2192715 | 108..298 | 100 | <- | Minus |
2L | 2192778..2192848 | 37..107 | 100 | <- | Minus |
2L | 2192975..2193010 | 1..36 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2192525..2192715 | 108..298 | 100 | <- | Minus |
2L | 2192778..2192848 | 37..107 | 100 | <- | Minus |
2L | 2192975..2193010 | 1..36 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2192525..2192715 | 108..298 | 100 | <- | Minus |
2L | 2192778..2192848 | 37..107 | 100 | <- | Minus |
2L | 2192975..2193010 | 1..36 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 2192525..2192715 | 108..298 | 100 | <- | Minus |
arm_2L | 2192778..2192848 | 37..107 | 100 | <- | Minus |
arm_2L | 2192975..2193010 | 1..36 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2192525..2192715 | 108..298 | 100 | <- | Minus |
2L | 2192778..2192848 | 37..107 | 100 | <- | Minus |
2L | 2192975..2193010 | 1..36 | 100 | Minus |
Translation from 62 to 250
> IP16915.hyp MALPDGLSNKMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVH LVYTMGFAKKKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34172-PD | 62 | CG34172-PD | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PC | 62 | CG34172-PC | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PB | 62 | CG34172-PB | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PA | 62 | CG34172-PA | 1..62 | 1..62 | 317 | 100 | Plus |
Translation from 62 to 250
> IP16915.pep MALPDGLSNKMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVH LVYTMGFAKKKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15302-PA | 62 | GF15302-PA | 1..62 | 1..62 | 299 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24551-PA | 62 | GG24551-PA | 1..62 | 1..62 | 307 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11473-PA | 297 | GH11473-PA | 248..297 | 13..62 | 209 | 72 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34172-PD | 62 | CG34172-PD | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PC | 62 | CG34172-PC | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PB | 62 | CG34172-PB | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PA | 62 | CG34172-PA | 1..62 | 1..62 | 317 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16950-PA | 62 | GI16950-PA | 1..62 | 1..62 | 258 | 75.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19418-PA | 62 | GL19418-PA | 1..62 | 1..62 | 277 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25953-PA | 62 | GA25953-PA | 1..62 | 1..62 | 277 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18260-PA | 62 | GM18260-PA | 1..62 | 1..62 | 311 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22869-PA | 62 | GD22869-PA | 1..62 | 1..62 | 311 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17215-PA | 73 | GJ17215-PA | 26..73 | 15..62 | 204 | 79.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15137-PA | 62 | GK15137-PA | 1..62 | 1..62 | 300 | 95.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15214-PA | 62 | GE15214-PA | 1..62 | 1..62 | 306 | 96.8 | Plus |