BDGP Sequence Production Resources |
Search the DGRC for IP16939
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 169 |
Well: | 39 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12963-RC |
Protein status: | IP16939.pep: gold |
Sequenced Size: | 800 |
Gene | Date | Evidence |
---|---|---|
CG12963 | 2008-04-29 | Release 5.5 accounting |
CG12963 | 2008-08-15 | Release 5.9 accounting |
CG12963 | 2008-12-18 | 5.12 accounting |
800 bp assembled on 2006-11-29
GenBank Submission: BT029587
> IP16939.complete ATTTGCTGCCACACATTTCCCAGACTCGGTTCAAAATGGATCTCGTCGAG GTGTATTACTTTATATCCTTCATTCTGATATTCCTTATTTTGATAAGGGC CTATATCTGTCCCAATCACAAGTGGAAGTGCGTCTGCTGCCTGCAATATC GGCACGAATCTGATCGTAATGTATTCAACGCACAGGAGGATCCTTCATCG AACCGCTATGGCGACATTTTCTTCATCGAACCCGGCAGCGTGGAGGCCAA CCGCATTCGCGATCAACTGGAAAAGGATGAAAAGGATTTACCCAGCTACG ACGAGGTGATGCGCATGTGTAACCTGACCACTCCCACAGCAGCAGCGGCT GGAATGCCTGTTCCCCAATCGCCCCTCGGTGTACCCAGTCCCATTGGAAT CGCGGCACTGCCGGCGCCACCGTATTCGGAGACAGATCCACATTCCTCGT CCGCCGCAGAAGCCACTGTCATCGCAATGGAACCGATGGAGCCATCCACC TCCCGCGCGGCACAGATTCCACCCAGCTCCGGATCTGGTCCTCCTGCTCC ATTGCCAACGACAGCGGTGTGATCCGTCGGAGGCATGGATAAATTGGAAC TGAAGCATTCGCCGTGCCACTCTGGGCCACACAGATGCCACTTTGTGTGC GCTTTCAGTACAGAAATGAACTTGTGTGATCTTATTGAGTACATACCTAT TTAAGTTCTAGACATTAGGAGTCGCATATTGTAAATATATATTTTTAGGA CATAGGATGAAAATTAAAGTGAATTATTTAATTGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 11448966..11449588 | 162..784 | 3115 | 100 | Plus |
chr2R | 21145070 | chr2R | 11443411..11443509 | 1..99 | 495 | 100 | Plus |
chr2R | 21145070 | chr2R | 11443565..11443629 | 98..162 | 325 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dbuz\Osvaldo | 9045 | Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). | 3427..3468 | 276..235 | 111 | 73.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 11443411..11443508 | 1..98 | 100 | -> | Plus |
chr2R | 11443566..11443629 | 99..162 | 100 | -> | Plus |
chr2R | 11448967..11449588 | 163..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 1..537 | 36..572 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 1..537 | 36..572 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 1..537 | 36..572 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 1..537 | 36..572 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 1..537 | 36..572 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 1..784 | 1..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 1..784 | 1..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 2..785 | 1..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 1..784 | 1..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12963-RC | 2..785 | 1..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15556260..15556357 | 1..98 | 100 | -> | Plus |
2R | 15556415..15556478 | 99..162 | 100 | -> | Plus |
2R | 15561815..15562436 | 163..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15556260..15556357 | 1..98 | 100 | -> | Plus |
2R | 15556415..15556478 | 99..162 | 100 | -> | Plus |
2R | 15561815..15562436 | 163..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15556260..15556357 | 1..98 | 100 | -> | Plus |
2R | 15556415..15556478 | 99..162 | 100 | -> | Plus |
2R | 15561815..15562436 | 163..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 11443765..11443862 | 1..98 | 100 | -> | Plus |
arm_2R | 11443920..11443983 | 99..162 | 100 | -> | Plus |
arm_2R | 11449320..11449941 | 163..784 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15557459..15557556 | 1..98 | 100 | -> | Plus |
2R | 15557614..15557677 | 99..162 | 100 | -> | Plus |
2R | 15563014..15563635 | 163..784 | 100 | Plus |
Translation from 2 to 571
> IP16939.pep LLPHISQTRFKMDLVEVYYFISFILIFLILIRAYICPNHKWKCVCCLQYR HESDRNVFNAQEDPSSNRYGDIFFIEPGSVEANRIRDQLEKDEKDLPSYD EVMRMCNLTTPTAAAAGMPVPQSPLGVPSPIGIAALPAPPYSETDPHSSS AAEATVIAMEPMEPSTSRAAQIPPSSGSGPPAPLPTTAV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11144-PA | 191 | GF11144-PA | 2..173 | 14..172 | 447 | 61.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20536-PA | 307 | GG20536-PA | 172..307 | 55..189 | 546 | 87.5 | Plus |
Dere\GG20535-PA | 151 | GG20535-PA | 94..146 | 1..53 | 284 | 94.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19971-PA | 172 | GH19971-PA | 56..164 | 59..169 | 247 | 55 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12963-PC | 178 | CG12963-PC | 1..178 | 12..189 | 942 | 100 | Plus |
CG12963-PM | 176 | CG12963-PM | 1..176 | 12..189 | 723 | 80.3 | Plus |
CG12963-PA | 190 | CG12963-PA | 7..190 | 20..189 | 719 | 80.4 | Plus |
CG12963-PI | 179 | CG12963-PI | 6..179 | 22..189 | 718 | 84.7 | Plus |
CG12963-PE | 203 | CG12963-PE | 29..203 | 19..189 | 715 | 82.3 | Plus |
CG12963-PL | 169 | CG12963-PL | 3..169 | 24..189 | 712 | 85 | Plus |
CG12963-PH | 197 | CG12963-PH | 58..197 | 50..189 | 712 | 97.9 | Plus |
CG12963-PF | 208 | CG12963-PF | 67..208 | 48..189 | 712 | 97.2 | Plus |
CG12963-PN | 180 | CG12963-PN | 1..180 | 12..189 | 710 | 78 | Plus |
CG12963-PJ | 179 | CG12963-PJ | 42..179 | 52..189 | 709 | 98.6 | Plus |
CG12963-PD | 186 | CG12963-PD | 50..186 | 53..189 | 707 | 99.3 | Plus |
CG12963-PG | 213 | CG12963-PG | 77..213 | 53..189 | 707 | 99.3 | Plus |
CG12963-PK | 200 | CG12963-PK | 65..200 | 54..189 | 706 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20257-PA | 258 | GI20257-PA | 147..256 | 67..172 | 284 | 67 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20080-PA | 201 | GL20080-PA | 61..196 | 58..188 | 368 | 66.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11943-PE | 190 | GA11943-PE | 1..185 | 12..188 | 403 | 55.2 | Plus |
Dpse\GA11943-PB | 197 | GA11943-PB | 5..192 | 18..188 | 391 | 51.6 | Plus |
Dpse\GA11943-PF | 193 | GA11943-PF | 53..188 | 58..188 | 386 | 65.7 | Plus |
Dpse\GA11943-PK | 214 | GA11943-PK | 13..209 | 14..188 | 386 | 50.7 | Plus |
Dpse\GA11943-PG | 180 | GA11943-PG | 38..175 | 56..188 | 383 | 64.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21627-PA | 190 | GM21627-PA | 44..190 | 50..189 | 662 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11129-PA | 190 | GD11129-PA | 44..190 | 50..189 | 675 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20211-PA | 171 | GJ20211-PA | 56..170 | 59..173 | 333 | 65 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23031-PA | 206 | GK23031-PA | 11..192 | 23..178 | 331 | 52.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11720-PA | 424 | GE11720-PA | 289..424 | 54..189 | 541 | 89 | Plus |
Translation from 2 to 571
> IP16939.hyp LLPHISQTRFKMDLVEVYYFISFILIFLILIRAYICPNHKWKCVCCLQYR HESDRNVFNAQEDPSSNRYGDIFFIEPGSVEANRIRDQLEKDEKDLPSYD EVMRMCNLTTPTAAAAGMPVPQSPLGVPSPIGIAALPAPPYSETDPHSSS AAEATVIAMEPMEPSTSRAAQIPPSSGSGPPAPLPTTAV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12963-PC | 178 | CG12963-PC | 1..178 | 12..189 | 942 | 100 | Plus |
CG12963-PM | 176 | CG12963-PM | 1..176 | 12..189 | 723 | 80.3 | Plus |
CG12963-PA | 190 | CG12963-PA | 7..190 | 20..189 | 719 | 80.4 | Plus |
CG12963-PI | 179 | CG12963-PI | 6..179 | 22..189 | 718 | 84.7 | Plus |
CG12963-PL | 169 | CG12963-PL | 3..169 | 24..189 | 712 | 85 | Plus |