Clone IP16939 Report

Search the DGRC for IP16939

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:169
Well:39
Vector:pOT2
Associated Gene/TranscriptCG12963-RC
Protein status:IP16939.pep: gold
Sequenced Size:800

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12963 2008-04-29 Release 5.5 accounting
CG12963 2008-08-15 Release 5.9 accounting
CG12963 2008-12-18 5.12 accounting

Clone Sequence Records

IP16939.complete Sequence

800 bp assembled on 2006-11-29

GenBank Submission: BT029587

> IP16939.complete
ATTTGCTGCCACACATTTCCCAGACTCGGTTCAAAATGGATCTCGTCGAG
GTGTATTACTTTATATCCTTCATTCTGATATTCCTTATTTTGATAAGGGC
CTATATCTGTCCCAATCACAAGTGGAAGTGCGTCTGCTGCCTGCAATATC
GGCACGAATCTGATCGTAATGTATTCAACGCACAGGAGGATCCTTCATCG
AACCGCTATGGCGACATTTTCTTCATCGAACCCGGCAGCGTGGAGGCCAA
CCGCATTCGCGATCAACTGGAAAAGGATGAAAAGGATTTACCCAGCTACG
ACGAGGTGATGCGCATGTGTAACCTGACCACTCCCACAGCAGCAGCGGCT
GGAATGCCTGTTCCCCAATCGCCCCTCGGTGTACCCAGTCCCATTGGAAT
CGCGGCACTGCCGGCGCCACCGTATTCGGAGACAGATCCACATTCCTCGT
CCGCCGCAGAAGCCACTGTCATCGCAATGGAACCGATGGAGCCATCCACC
TCCCGCGCGGCACAGATTCCACCCAGCTCCGGATCTGGTCCTCCTGCTCC
ATTGCCAACGACAGCGGTGTGATCCGTCGGAGGCATGGATAAATTGGAAC
TGAAGCATTCGCCGTGCCACTCTGGGCCACACAGATGCCACTTTGTGTGC
GCTTTCAGTACAGAAATGAACTTGTGTGATCTTATTGAGTACATACCTAT
TTAAGTTCTAGACATTAGGAGTCGCATATTGTAAATATATATTTTTAGGA
CATAGGATGAAAATTAAAGTGAATTATTTAATTGAAAAAAAAAAAAAAAA

IP16939.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963-RC 944 CG12963-RC 34..821 1..788 3940 100 Plus
CG12963.a 1256 CG12963.a 346..1133 1..788 3940 100 Plus
CG12963.j 1478 CG12963.j 732..1360 160..788 3145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11448966..11449588 162..784 3115 100 Plus
chr2R 21145070 chr2R 11443411..11443509 1..99 495 100 Plus
chr2R 21145070 chr2R 11443565..11443629 98..162 325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:29:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15561814..15562440 162..788 3135 100 Plus
2R 25286936 2R 15556260..15556358 1..99 495 100 Plus
2R 25286936 2R 15556414..15556478 98..162 325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15563013..15563639 162..788 3135 100 Plus
2R 25260384 2R 15557459..15557557 1..99 495 100 Plus
2R 25260384 2R 15557613..15557677 98..162 325 100 Plus
Blast to na_te.dros performed 2019-03-15 14:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 3427..3468 276..235 111 73.8 Minus

IP16939.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:50:41 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11443411..11443508 1..98 100 -> Plus
chr2R 11443566..11443629 99..162 100 -> Plus
chr2R 11448967..11449588 163..784 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:05:00 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 1..537 36..572 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:16:22 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 1..537 36..572 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:43:48 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 1..537 36..572 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:27:06 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 1..537 36..572 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:10:00 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 1..537 36..572 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:44:55 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 1..784 1..784 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:16:21 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 1..784 1..784 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:43:48 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 2..785 1..784 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:27:06 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 1..784 1..784 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:10:00 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RC 2..785 1..784 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:41 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15556260..15556357 1..98 100 -> Plus
2R 15556415..15556478 99..162 100 -> Plus
2R 15561815..15562436 163..784 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:41 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15556260..15556357 1..98 100 -> Plus
2R 15556415..15556478 99..162 100 -> Plus
2R 15561815..15562436 163..784 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:50:41 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15556260..15556357 1..98 100 -> Plus
2R 15556415..15556478 99..162 100 -> Plus
2R 15561815..15562436 163..784 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:43:48 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11443765..11443862 1..98 100 -> Plus
arm_2R 11443920..11443983 99..162 100 -> Plus
arm_2R 11449320..11449941 163..784 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:46:41 Download gff for IP16939.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15557459..15557556 1..98 100 -> Plus
2R 15557614..15557677 99..162 100 -> Plus
2R 15563014..15563635 163..784 100   Plus

IP16939.pep Sequence

Translation from 2 to 571

> IP16939.pep
LLPHISQTRFKMDLVEVYYFISFILIFLILIRAYICPNHKWKCVCCLQYR
HESDRNVFNAQEDPSSNRYGDIFFIEPGSVEANRIRDQLEKDEKDLPSYD
EVMRMCNLTTPTAAAAGMPVPQSPLGVPSPIGIAALPAPPYSETDPHSSS
AAEATVIAMEPMEPSTSRAAQIPPSSGSGPPAPLPTTAV*

IP16939.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11144-PA 191 GF11144-PA 2..173 14..172 447 61.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20536-PA 307 GG20536-PA 172..307 55..189 546 87.5 Plus
Dere\GG20535-PA 151 GG20535-PA 94..146 1..53 284 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19971-PA 172 GH19971-PA 56..164 59..169 247 55 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963-PC 178 CG12963-PC 1..178 12..189 942 100 Plus
CG12963-PM 176 CG12963-PM 1..176 12..189 723 80.3 Plus
CG12963-PA 190 CG12963-PA 7..190 20..189 719 80.4 Plus
CG12963-PI 179 CG12963-PI 6..179 22..189 718 84.7 Plus
CG12963-PE 203 CG12963-PE 29..203 19..189 715 82.3 Plus
CG12963-PL 169 CG12963-PL 3..169 24..189 712 85 Plus
CG12963-PH 197 CG12963-PH 58..197 50..189 712 97.9 Plus
CG12963-PF 208 CG12963-PF 67..208 48..189 712 97.2 Plus
CG12963-PN 180 CG12963-PN 1..180 12..189 710 78 Plus
CG12963-PJ 179 CG12963-PJ 42..179 52..189 709 98.6 Plus
CG12963-PD 186 CG12963-PD 50..186 53..189 707 99.3 Plus
CG12963-PG 213 CG12963-PG 77..213 53..189 707 99.3 Plus
CG12963-PK 200 CG12963-PK 65..200 54..189 706 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20257-PA 258 GI20257-PA 147..256 67..172 284 67 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20080-PA 201 GL20080-PA 61..196 58..188 368 66.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11943-PE 190 GA11943-PE 1..185 12..188 403 55.2 Plus
Dpse\GA11943-PB 197 GA11943-PB 5..192 18..188 391 51.6 Plus
Dpse\GA11943-PF 193 GA11943-PF 53..188 58..188 386 65.7 Plus
Dpse\GA11943-PK 214 GA11943-PK 13..209 14..188 386 50.7 Plus
Dpse\GA11943-PG 180 GA11943-PG 38..175 56..188 383 64.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21627-PA 190 GM21627-PA 44..190 50..189 662 90.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11129-PA 190 GD11129-PA 44..190 50..189 675 91.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20211-PA 171 GJ20211-PA 56..170 59..173 333 65 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23031-PA 206 GK23031-PA 11..192 23..178 331 52.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11720-PA 424 GE11720-PA 289..424 54..189 541 89 Plus

IP16939.hyp Sequence

Translation from 2 to 571

> IP16939.hyp
LLPHISQTRFKMDLVEVYYFISFILIFLILIRAYICPNHKWKCVCCLQYR
HESDRNVFNAQEDPSSNRYGDIFFIEPGSVEANRIRDQLEKDEKDLPSYD
EVMRMCNLTTPTAAAAGMPVPQSPLGVPSPIGIAALPAPPYSETDPHSSS
AAEATVIAMEPMEPSTSRAAQIPPSSGSGPPAPLPTTAV*

IP16939.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963-PC 178 CG12963-PC 1..178 12..189 942 100 Plus
CG12963-PM 176 CG12963-PM 1..176 12..189 723 80.3 Plus
CG12963-PA 190 CG12963-PA 7..190 20..189 719 80.4 Plus
CG12963-PI 179 CG12963-PI 6..179 22..189 718 84.7 Plus
CG12963-PL 169 CG12963-PL 3..169 24..189 712 85 Plus