BDGP Sequence Production Resources |
Search the DGRC for IP16948
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 169 |
Well: | 48 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34199-RA |
Protein status: | IP16948.pep: gold |
Sequenced Size: | 694 |
Gene | Date | Evidence |
---|---|---|
CG34199 | 2008-04-29 | Release 5.5 accounting |
CG34199 | 2008-08-15 | Release 5.9 accounting |
CG34199 | 2008-12-18 | 5.12 accounting |
694 bp assembled on 2006-11-28
GenBank Submission: BT029589
> IP16948.complete CCGTTCATTAAAATGGTGACAAAGTTGCTTCTACTGCTGCCATTTGTGGC CATTGTACAAGCTGAAGTGGATTTTACCGGTGGACGTATAGCACCTTATG CACCAACTGGTTGGCATCCGCAGATTCCATTCAACTTACCCAACGAGTAT GTGCCTGCTATCCGATCAAGTCAGGGAGTAGAAATCACAAAGGCACGAGT GGACCAGTTCGATCCAGTGGAAAAGCCCCAGCCAAATTATTTGCCTCCAA ATCAACTGGATATACCCGAGGAAGAGATTTTGCCCACCTCACGACCGTCC AACAAGTACGGTCCGGCAGATCCGAAATTTAAAATCATTTATCCTGATGA TGAGGAGCCAGTTACTGCAAAAAATATCGTAGACAATCAGCAGCCCAAAA TCAGAGAGGGACGTTACTTCGTCATTTCGCAGGACAATAAACTACAAAGA GTTTCTTTCAGCTCCCAGCAAAACGCAGATGCAGATGCAGATGATTTTAC GGCTCAGTTGACTTACTCCACTGTGGGGCAACTCAAGGATCCTGTGTATC GATACAACAGACAGGGACAACTGGAGCGGGTCCTGAAGTAGGCAATTTGG ATATAGCTATTTGAATATGTAAAATAGAGTTGTGCAATGTATTCAATTCT CAGAATGAATTATCTTGTTAATTATAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34199-RA | 775 | CG34199-RA | 101..775 | 1..675 | 3375 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 16174726..16175380 | 21..675 | 3275 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 20287692..20288351 | 21..680 | 3300 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 20288891..20289550 | 21..680 | 3300 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
invader6 | 4885 | invader6 INVADER6 4885bp | 1570..1640 | 567..637 | 111 | 65.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 16174649..16174672 | 1..24 | 100 | -> | Plus |
chr2R | 16174730..16175380 | 25..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 1..579 | 13..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 1..579 | 13..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 1..579 | 13..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 1..579 | 13..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 1..579 | 13..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 1..675 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 1..675 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 20..694 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 1..675 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34199-RA | 20..694 | 1..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20287615..20287638 | 1..24 | 100 | -> | Plus |
2R | 20287696..20288346 | 25..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20287615..20287638 | 1..24 | 100 | -> | Plus |
2R | 20287696..20288346 | 25..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20287615..20287638 | 1..24 | 100 | -> | Plus |
2R | 20287696..20288346 | 25..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 16175120..16175143 | 1..24 | 100 | -> | Plus |
arm_2R | 16175201..16175851 | 25..675 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20288814..20288837 | 1..24 | 100 | -> | Plus |
2R | 20288895..20289545 | 25..675 | 100 | Plus |
Translation from 0 to 590
> IP16948.hyp PFIKMVTKLLLLLPFVAIVQAEVDFTGGRIAPYAPTGWHPQIPFNLPNEY VPAIRSSQGVEITKARVDQFDPVEKPQPNYLPPNQLDIPEEEILPTSRPS NKYGPADPKFKIIYPDDEEPVTAKNIVDNQQPKIREGRYFVISQDNKLQR VSFSSQQNADADADDFTAQLTYSTVGQLKDPVYRYNRQGQLERVLK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34199-PA | 192 | CG34199-PA | 1..192 | 5..196 | 1007 | 100 | Plus |
Translation from 0 to 590
> IP16948.pep PFIKMVTKLLLLLPFVAIVQAEVDFTGGRIAPYAPTGWHPQIPFNLPNEY VPAIRSSQGVEITKARVDQFDPVEKPQPNYLPPNQLDIPEEEILPTSRPS NKYGPADPKFKIIYPDDEEPVTAKNIVDNQQPKIREGRYFVISQDNKLQR VSFSSQQNADADADDFTAQLTYSTVGQLKDPVYRYNRQGQLERVLK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12258-PA | 188 | GF12258-PA | 1..188 | 5..196 | 562 | 59.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22023-PA | 196 | GG22023-PA | 11..196 | 6..196 | 764 | 81.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21822-PA | 192 | GH21822-PA | 23..192 | 30..196 | 352 | 46.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34199-PA | 192 | CG34199-PA | 1..192 | 5..196 | 1007 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20793-PA | 189 | GI20793-PA | 1..189 | 5..196 | 358 | 43.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17631-PA | 207 | GL17631-PA | 1..207 | 5..196 | 528 | 54.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24854-PA | 207 | GA24854-PA | 1..207 | 5..196 | 517 | 53.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22005-PA | 199 | GM22005-PA | 11..199 | 6..196 | 871 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11504-PA | 199 | GD11504-PA | 11..199 | 6..196 | 859 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20528-PA | 193 | GJ20528-PA | 1..193 | 5..196 | 400 | 46.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19624-PA | 157 | GK19624-PA | 18..157 | 31..196 | 343 | 47 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12101-PA | 179 | GE12101-PA | 1..179 | 16..196 | 767 | 82.9 | Plus |