Clone IP16948 Report

Search the DGRC for IP16948

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:169
Well:48
Vector:pOT2
Associated Gene/TranscriptCG34199-RA
Protein status:IP16948.pep: gold
Sequenced Size:694

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34199 2008-04-29 Release 5.5 accounting
CG34199 2008-08-15 Release 5.9 accounting
CG34199 2008-12-18 5.12 accounting

Clone Sequence Records

IP16948.complete Sequence

694 bp assembled on 2006-11-28

GenBank Submission: BT029589

> IP16948.complete
CCGTTCATTAAAATGGTGACAAAGTTGCTTCTACTGCTGCCATTTGTGGC
CATTGTACAAGCTGAAGTGGATTTTACCGGTGGACGTATAGCACCTTATG
CACCAACTGGTTGGCATCCGCAGATTCCATTCAACTTACCCAACGAGTAT
GTGCCTGCTATCCGATCAAGTCAGGGAGTAGAAATCACAAAGGCACGAGT
GGACCAGTTCGATCCAGTGGAAAAGCCCCAGCCAAATTATTTGCCTCCAA
ATCAACTGGATATACCCGAGGAAGAGATTTTGCCCACCTCACGACCGTCC
AACAAGTACGGTCCGGCAGATCCGAAATTTAAAATCATTTATCCTGATGA
TGAGGAGCCAGTTACTGCAAAAAATATCGTAGACAATCAGCAGCCCAAAA
TCAGAGAGGGACGTTACTTCGTCATTTCGCAGGACAATAAACTACAAAGA
GTTTCTTTCAGCTCCCAGCAAAACGCAGATGCAGATGCAGATGATTTTAC
GGCTCAGTTGACTTACTCCACTGTGGGGCAACTCAAGGATCCTGTGTATC
GATACAACAGACAGGGACAACTGGAGCGGGTCCTGAAGTAGGCAATTTGG
ATATAGCTATTTGAATATGTAAAATAGAGTTGTGCAATGTATTCAATTCT
CAGAATGAATTATCTTGTTAATTATAAAAAAAAAAAAAAAAAAA

IP16948.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34199-RA 775 CG34199-RA 101..775 1..675 3375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16174726..16175380 21..675 3275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:29:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20287692..20288351 21..680 3300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20288891..20289550 21..680 3300 100 Plus
Blast to na_te.dros performed 2019-03-16 00:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
invader6 4885 invader6 INVADER6 4885bp 1570..1640 567..637 111 65.3 Plus

IP16948.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:40:37 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16174649..16174672 1..24 100 -> Plus
chr2R 16174730..16175380 25..675 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:05:03 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 1..579 13..591 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:31 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 1..579 13..591 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:36 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 1..579 13..591 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:06:59 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 1..579 13..591 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:08:06 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 1..579 13..591 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:17 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 1..675 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:30 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 1..675 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:36 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 20..694 1..675 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:07:00 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 1..675 1..675 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:08:06 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
CG34199-RA 20..694 1..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:37 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20287615..20287638 1..24 100 -> Plus
2R 20287696..20288346 25..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:37 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20287615..20287638 1..24 100 -> Plus
2R 20287696..20288346 25..675 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:37 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20287615..20287638 1..24 100 -> Plus
2R 20287696..20288346 25..675 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:36 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16175120..16175143 1..24 100 -> Plus
arm_2R 16175201..16175851 25..675 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:30 Download gff for IP16948.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20288814..20288837 1..24 100 -> Plus
2R 20288895..20289545 25..675 100   Plus

IP16948.hyp Sequence

Translation from 0 to 590

> IP16948.hyp
PFIKMVTKLLLLLPFVAIVQAEVDFTGGRIAPYAPTGWHPQIPFNLPNEY
VPAIRSSQGVEITKARVDQFDPVEKPQPNYLPPNQLDIPEEEILPTSRPS
NKYGPADPKFKIIYPDDEEPVTAKNIVDNQQPKIREGRYFVISQDNKLQR
VSFSSQQNADADADDFTAQLTYSTVGQLKDPVYRYNRQGQLERVLK*

IP16948.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34199-PA 192 CG34199-PA 1..192 5..196 1007 100 Plus

IP16948.pep Sequence

Translation from 0 to 590

> IP16948.pep
PFIKMVTKLLLLLPFVAIVQAEVDFTGGRIAPYAPTGWHPQIPFNLPNEY
VPAIRSSQGVEITKARVDQFDPVEKPQPNYLPPNQLDIPEEEILPTSRPS
NKYGPADPKFKIIYPDDEEPVTAKNIVDNQQPKIREGRYFVISQDNKLQR
VSFSSQQNADADADDFTAQLTYSTVGQLKDPVYRYNRQGQLERVLK*

IP16948.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12258-PA 188 GF12258-PA 1..188 5..196 562 59.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22023-PA 196 GG22023-PA 11..196 6..196 764 81.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21822-PA 192 GH21822-PA 23..192 30..196 352 46.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34199-PA 192 CG34199-PA 1..192 5..196 1007 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20793-PA 189 GI20793-PA 1..189 5..196 358 43.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17631-PA 207 GL17631-PA 1..207 5..196 528 54.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24854-PA 207 GA24854-PA 1..207 5..196 517 53.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22005-PA 199 GM22005-PA 11..199 6..196 871 89 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11504-PA 199 GD11504-PA 11..199 6..196 859 88 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20528-PA 193 GJ20528-PA 1..193 5..196 400 46.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19624-PA 157 GK19624-PA 18..157 31..196 343 47 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12101-PA 179 GE12101-PA 1..179 16..196 767 82.9 Plus