BDGP Sequence Production Resources |
Search the DGRC for IP16951
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 169 |
Well: | 51 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34115-RA |
Protein status: | IP16951.pep: gold |
Sequenced Size: | 410 |
Gene | Date | Evidence |
---|---|---|
CG34115 | 2008-04-29 | Release 5.5 accounting |
CG34115 | 2008-08-15 | Release 5.9 accounting |
CG34115 | 2008-12-18 | 5.12 accounting |
410 bp assembled on 2006-11-29
GenBank Submission: BT029590
> IP16951.complete ACAACCTCGTACCGCTCGCTCGCAGCTTTAGCTTTACCGTTACACCAGTG ATTGAGCACTACAATATCCGAAAAAACCATGGCTAAATTGAGTGCCCTGC TGCTGCCCCTAATTTTGTTTATTGTGGCCTTTGTGGCGCACACAACTTTT GCTACAGTGCAGCCAAAAGCACCGAACTTCCAGTACTTCGAAAGGCCCAA GTACCGTTATCCCTACTACGATGAACACGGGCGCGGAAAACTTCTCTACG GCTACGGCGGACCGGAATTGTACCAATACAAGACCTACACGCCCTTGGAG GGCATTCACTAGTCCTAAATATCGATTAGATGCAATGTAGTCCGTAATTT ATGTATTCTATTATTTAAATTAAACTTTCTTTATTACCCCAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34115-RA | 461 | CG34115-RA | 67..461 | 1..395 | 1975 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 16863183..16863389 | 193..390 | 850 | 95.2 | Plus |
chr2R | 21145070 | chr2R | 16861970..16862085 | 1..116 | 520 | 96.6 | Plus |
chr2R | 21145070 | chr2R | 16863041..16863127 | 109..195 | 420 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 20976737..20976939 | 193..395 | 1015 | 100 | Plus |
2R | 25286936 | 2R | 20975516..20975631 | 1..116 | 550 | 98.3 | Plus |
2R | 25286936 | 2R | 20976595..20976681 | 109..195 | 435 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 20977936..20978138 | 193..395 | 1015 | 100 | Plus |
2R | 25260384 | 2R | 20976715..20976830 | 1..116 | 550 | 98.2 | Plus |
2R | 25260384 | 2R | 20977794..20977880 | 109..195 | 435 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmer\R1A3 | 3772 | Dmer\R1A3 MERCR1A3 3772bp | 691..747 | 95..152 | 107 | 67.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 16861970..16862077 | 1..108 | 98 | -> | Plus |
chr2R | 16863041..16863126 | 109..194 | 98 | -> | Plus |
chr2R | 16863185..16863389 | 195..390 | 95 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 1..234 | 79..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 1..234 | 79..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 1..234 | 79..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 1..234 | 79..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 1..234 | 79..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 1..390 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 17..406 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 29..418 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 1..390 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34115-RA | 29..418 | 1..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20975516..20975623 | 1..108 | 100 | -> | Plus |
2R | 20976595..20976680 | 109..194 | 100 | -> | Plus |
2R | 20976739..20976934 | 195..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20975516..20975623 | 1..108 | 100 | -> | Plus |
2R | 20976595..20976680 | 109..194 | 100 | -> | Plus |
2R | 20976739..20976934 | 195..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20975516..20975623 | 1..108 | 100 | -> | Plus |
2R | 20976595..20976680 | 109..194 | 100 | -> | Plus |
2R | 20976739..20976934 | 195..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 16863021..16863128 | 1..108 | 100 | -> | Plus |
arm_2R | 16864100..16864185 | 109..194 | 100 | -> | Plus |
arm_2R | 16864244..16864439 | 195..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20976715..20976822 | 1..108 | 100 | -> | Plus |
2R | 20977794..20977879 | 109..194 | 100 | -> | Plus |
2R | 20977938..20978133 | 195..390 | 100 | Plus |
Translation from 78 to 311
> IP16951.hyp MAKLSALLLPLILFIVAFVAHTTFATVQPKAPNFQYFERPKYRYPYYDEH GRGKLLYGYGGPELYQYKTYTPLEGIH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34115-PA | 77 | CG34115-PA | 1..77 | 1..77 | 418 | 100 | Plus |
Translation from 78 to 311
> IP16951.pep MAKLSALLLPLILFIVAFVAHTTFATVQPKAPNFQYFERPKYRYPYYDEH GRGKLLYGYGGPELYQYKTYTPLEGIH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12210-PA | 77 | GF12210-PA | 1..77 | 1..77 | 309 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22070-PA | 77 | GG22070-PA | 1..77 | 1..77 | 391 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34115-PA | 77 | CG34115-PA | 1..77 | 1..77 | 418 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19713-PA | 77 | GI19713-PA | 1..77 | 1..77 | 349 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17064-PA | 77 | GL17064-PA | 15..77 | 15..77 | 310 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24348-PA | 77 | GA24348-PA | 18..77 | 18..77 | 296 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15789-PA | 77 | GM15789-PA | 1..77 | 1..77 | 391 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11550-PA | 77 | GD11550-PA | 1..77 | 1..77 | 391 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17490-PA | 77 | GJ17490-PA | 16..77 | 16..77 | 307 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12151-PA | 77 | GE12151-PA | 1..77 | 1..77 | 389 | 97.4 | Plus |