Clone IP16951 Report

Search the DGRC for IP16951

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:169
Well:51
Vector:pOT2
Associated Gene/TranscriptCG34115-RA
Protein status:IP16951.pep: gold
Sequenced Size:410

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34115 2008-04-29 Release 5.5 accounting
CG34115 2008-08-15 Release 5.9 accounting
CG34115 2008-12-18 5.12 accounting

Clone Sequence Records

IP16951.complete Sequence

410 bp assembled on 2006-11-29

GenBank Submission: BT029590

> IP16951.complete
ACAACCTCGTACCGCTCGCTCGCAGCTTTAGCTTTACCGTTACACCAGTG
ATTGAGCACTACAATATCCGAAAAAACCATGGCTAAATTGAGTGCCCTGC
TGCTGCCCCTAATTTTGTTTATTGTGGCCTTTGTGGCGCACACAACTTTT
GCTACAGTGCAGCCAAAAGCACCGAACTTCCAGTACTTCGAAAGGCCCAA
GTACCGTTATCCCTACTACGATGAACACGGGCGCGGAAAACTTCTCTACG
GCTACGGCGGACCGGAATTGTACCAATACAAGACCTACACGCCCTTGGAG
GGCATTCACTAGTCCTAAATATCGATTAGATGCAATGTAGTCCGTAATTT
ATGTATTCTATTATTTAAATTAAACTTTCTTTATTACCCCAAAAAAAAAA
AAAAAAAAAA

IP16951.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34115-RA 461 CG34115-RA 67..461 1..395 1975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16863183..16863389 193..390 850 95.2 Plus
chr2R 21145070 chr2R 16861970..16862085 1..116 520 96.6 Plus
chr2R 21145070 chr2R 16863041..16863127 109..195 420 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:29:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20976737..20976939 193..395 1015 100 Plus
2R 25286936 2R 20975516..20975631 1..116 550 98.3 Plus
2R 25286936 2R 20976595..20976681 109..195 435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20977936..20978138 193..395 1015 100 Plus
2R 25260384 2R 20976715..20976830 1..116 550 98.2 Plus
2R 25260384 2R 20977794..20977880 109..195 435 100 Plus
Blast to na_te.dros performed 2019-03-15 19:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 691..747 95..152 107 67.2 Plus

IP16951.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:59:51 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16861970..16862077 1..108 98 -> Plus
chr2R 16863041..16863126 109..194 98 -> Plus
chr2R 16863185..16863389 195..390 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:05:04 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 1..234 79..312 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:23 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 1..234 79..312 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:20:19 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 1..234 79..312 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:06:35 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 1..234 79..312 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:26 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 1..234 79..312 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:09 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 1..390 1..390 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:23 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 17..406 1..390 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:20:19 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 29..418 1..390 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:06:35 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 1..390 1..390 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:26 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 29..418 1..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:51 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20975516..20975623 1..108 100 -> Plus
2R 20976595..20976680 109..194 100 -> Plus
2R 20976739..20976934 195..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:51 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20975516..20975623 1..108 100 -> Plus
2R 20976595..20976680 109..194 100 -> Plus
2R 20976739..20976934 195..390 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:59:51 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20975516..20975623 1..108 100 -> Plus
2R 20976595..20976680 109..194 100 -> Plus
2R 20976739..20976934 195..390 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:20:19 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16863021..16863128 1..108 100 -> Plus
arm_2R 16864100..16864185 109..194 100 -> Plus
arm_2R 16864244..16864439 195..390 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:24 Download gff for IP16951.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20976715..20976822 1..108 100 -> Plus
2R 20977794..20977879 109..194 100 -> Plus
2R 20977938..20978133 195..390 100   Plus

IP16951.hyp Sequence

Translation from 78 to 311

> IP16951.hyp
MAKLSALLLPLILFIVAFVAHTTFATVQPKAPNFQYFERPKYRYPYYDEH
GRGKLLYGYGGPELYQYKTYTPLEGIH*

IP16951.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG34115-PA 77 CG34115-PA 1..77 1..77 418 100 Plus

IP16951.pep Sequence

Translation from 78 to 311

> IP16951.pep
MAKLSALLLPLILFIVAFVAHTTFATVQPKAPNFQYFERPKYRYPYYDEH
GRGKLLYGYGGPELYQYKTYTPLEGIH*

IP16951.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12210-PA 77 GF12210-PA 1..77 1..77 309 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22070-PA 77 GG22070-PA 1..77 1..77 391 98.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34115-PA 77 CG34115-PA 1..77 1..77 418 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19713-PA 77 GI19713-PA 1..77 1..77 349 84.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17064-PA 77 GL17064-PA 15..77 15..77 310 92.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24348-PA 77 GA24348-PA 18..77 18..77 296 93.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15789-PA 77 GM15789-PA 1..77 1..77 391 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11550-PA 77 GD11550-PA 1..77 1..77 391 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17490-PA 77 GJ17490-PA 16..77 16..77 307 91.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12151-PA 77 GE12151-PA 1..77 1..77 389 97.4 Plus