BDGP Sequence Production Resources |
Search the DGRC for IP16979
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 169 |
Well: | 79 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34228-RA |
Protein status: | IP16979.pep: gold |
Sequenced Size: | 379 |
Gene | Date | Evidence |
---|---|---|
CG34228 | 2008-04-29 | Release 5.5 accounting |
CG34228 | 2008-08-15 | Release 5.9 accounting |
CG34228 | 2008-12-18 | 5.12 accounting |
379 bp assembled on 2006-11-28
GenBank Submission: BT029595
> IP16979.complete TATTAACCGAAAATATTAATCAAGATGTGGCCAATTGTTATGGCTCTAAT TAGGCGTAACGCCGTTTACATCACGTTGCCCATAGCCGGCGTTGTGGGTT TTATTGGCTATAACATAGAGAGTTGGATATCTGACAAATACACCCCATAC AGTCCATCCATACAAGAGTTGCGCGCTAAACGGTTGACAGAAGAAAGTTT GAATACAGATGCCGCTAATGTGGAAAAATTACGACTGAGTAGTCCCGTAC TGGAACGCAACCTCTCCCCGTCGCTACAGCCCAAGGCCTAAACATATACC ATGATTTGTTATCAAAATTAGAAAGTTGTTACCAATAAAAAAAAAAGATA CGCCAAAAATAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34228-RA | 544 | CG34228-RA | 187..544 | 1..358 | 1790 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7539242..7539395 | 1..154 | 99 | -> | Plus |
chr2R | 7539464..7539669 | 155..360 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 1..267 | 25..291 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 1..267 | 25..291 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 1..267 | 25..291 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 1..267 | 25..291 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 1..267 | 25..291 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 42..395 | 1..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 42..395 | 1..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 62..415 | 1..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 42..395 | 1..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34228-RA | 62..415 | 1..354 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11651918..11652071 | 1..154 | 100 | -> | Plus |
2R | 11652140..11652345 | 155..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11651918..11652071 | 1..154 | 100 | -> | Plus |
2R | 11652140..11652345 | 155..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11651918..11652071 | 1..154 | 100 | -> | Plus |
2R | 11652140..11652345 | 155..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7539423..7539576 | 1..154 | 100 | -> | Plus |
arm_2R | 7539645..7539850 | 155..360 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11653117..11653270 | 1..154 | 100 | -> | Plus |
2R | 11653339..11653544 | 155..360 | 100 | Plus |
Translation from 24 to 290
> IP16979.hyp MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPYSPSIQELR AKRLTEESLNTDAANVEKLRLSSPVLERNLSPSLQPKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34228-PA | 88 | CG34228-PA | 1..88 | 1..88 | 445 | 100 | Plus |
Translation from 24 to 290
> IP16979.pep MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPYSPSIQELR AKRLTEESLNTDAANVEKLRLSSPVLERNLSPSLQPKA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13112-PA | 89 | GF13112-PA | 1..88 | 1..88 | 402 | 85.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20210-PA | 83 | GG20210-PA | 1..82 | 6..87 | 417 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21391-PA | 88 | GH21391-PA | 1..87 | 1..87 | 361 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34228-PA | 88 | CG34228-PA | 1..88 | 1..88 | 445 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18570-PA | 86 | GI18570-PA | 1..85 | 1..87 | 348 | 77 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11417-PA | 88 | GL11417-PA | 1..88 | 1..88 | 376 | 80.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24719-PA | 83 | GA24719-PA | 1..83 | 6..88 | 352 | 80.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21296-PA | 88 | GM21296-PA | 1..88 | 1..88 | 450 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10804-PA | 88 | GD10804-PA | 1..88 | 1..88 | 450 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20364-PA | 83 | GJ20364-PA | 1..83 | 6..88 | 339 | 77.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22110-PA | 85 | GK22110-PA | 1..83 | 1..88 | 325 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12371-PA | 83 | GE12371-PA | 1..83 | 6..88 | 422 | 100 | Plus |