Clone IP16979 Report

Search the DGRC for IP16979

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:169
Well:79
Vector:pOT2
Associated Gene/TranscriptCG34228-RA
Protein status:IP16979.pep: gold
Sequenced Size:379

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34228 2008-04-29 Release 5.5 accounting
CG34228 2008-08-15 Release 5.9 accounting
CG34228 2008-12-18 5.12 accounting

Clone Sequence Records

IP16979.complete Sequence

379 bp assembled on 2006-11-28

GenBank Submission: BT029595

> IP16979.complete
TATTAACCGAAAATATTAATCAAGATGTGGCCAATTGTTATGGCTCTAAT
TAGGCGTAACGCCGTTTACATCACGTTGCCCATAGCCGGCGTTGTGGGTT
TTATTGGCTATAACATAGAGAGTTGGATATCTGACAAATACACCCCATAC
AGTCCATCCATACAAGAGTTGCGCGCTAAACGGTTGACAGAAGAAAGTTT
GAATACAGATGCCGCTAATGTGGAAAAATTACGACTGAGTAGTCCCGTAC
TGGAACGCAACCTCTCCCCGTCGCTACAGCCCAAGGCCTAAACATATACC
ATGATTTGTTATCAAAATTAGAAAGTTGTTACCAATAAAAAAAAAAGATA
CGCCAAAAATAAAAAAAAAAAAAAAAAAA

IP16979.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-RA 544 CG34228-RA 187..544 1..358 1790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7539464..7539669 155..360 1000 99 Plus
chr2R 21145070 chr2R 7539242..7539395 1..154 755 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:29:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11652140..11652347 155..362 1040 100 Plus
2R 25286936 2R 11651918..11652071 1..154 770 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11653339..11653546 155..362 1040 100 Plus
2R 25260384 2R 11653117..11653270 1..154 770 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:47:26 has no hits.

IP16979.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:48:29 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7539242..7539395 1..154 99 -> Plus
chr2R 7539464..7539669 155..360 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:05:25 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 1..267 25..291 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:01:49 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 1..267 25..291 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:20:52 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 1..267 25..291 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:39 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 1..267 25..291 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:27 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 1..267 25..291 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:26:55 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 42..395 1..354 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:01:49 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 42..395 1..354 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:20:52 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 62..415 1..354 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:39 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 42..395 1..354 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:27 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 62..415 1..354 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:29 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11651918..11652071 1..154 100 -> Plus
2R 11652140..11652345 155..360 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:29 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11651918..11652071 1..154 100 -> Plus
2R 11652140..11652345 155..360 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:29 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11651918..11652071 1..154 100 -> Plus
2R 11652140..11652345 155..360 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:20:52 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7539423..7539576 1..154 100 -> Plus
arm_2R 7539645..7539850 155..360 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:39 Download gff for IP16979.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11653117..11653270 1..154 100 -> Plus
2R 11653339..11653544 155..360 100   Plus

IP16979.hyp Sequence

Translation from 24 to 290

> IP16979.hyp
MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPYSPSIQELR
AKRLTEESLNTDAANVEKLRLSSPVLERNLSPSLQPKA*

IP16979.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-PA 88 CG34228-PA 1..88 1..88 445 100 Plus

IP16979.pep Sequence

Translation from 24 to 290

> IP16979.pep
MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPYSPSIQELR
AKRLTEESLNTDAANVEKLRLSSPVLERNLSPSLQPKA*

IP16979.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13112-PA 89 GF13112-PA 1..88 1..88 402 85.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20210-PA 83 GG20210-PA 1..82 6..87 417 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21391-PA 88 GH21391-PA 1..87 1..87 361 79.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-PA 88 CG34228-PA 1..88 1..88 445 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18570-PA 86 GI18570-PA 1..85 1..87 348 77 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11417-PA 88 GL11417-PA 1..88 1..88 376 80.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24719-PA 83 GA24719-PA 1..83 6..88 352 80.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21296-PA 88 GM21296-PA 1..88 1..88 450 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10804-PA 88 GD10804-PA 1..88 1..88 450 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20364-PA 83 GJ20364-PA 1..83 6..88 339 77.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22110-PA 85 GK22110-PA 1..83 1..88 325 75 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12371-PA 83 GE12371-PA 1..83 6..88 422 100 Plus