Clone IP16980 Report

Search the DGRC for IP16980

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:169
Well:80
Vector:pOT2
Associated Gene/TranscriptCG34230-RA
Protein status:IP16980.pep: gold
Sequenced Size:557

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34230 2008-04-29 Release 5.5 accounting
CG34230 2008-08-15 Release 5.9 accounting
CG34230 2008-12-18 5.12 accounting

Clone Sequence Records

IP16980.complete Sequence

557 bp assembled on 2006-11-30

GenBank Submission: BT029596

> IP16980.complete
AGTTCGTATCCGAAATTGGCTTAGAAACCCCCCAAAAAGAAACGAAAATG
ATCTACTCGGACAATTGCTGTTGCTGCGTGGATCTGAAGTGCGGAAGCAT
CCTGATAGCCATCGTTGAGGTGCTAATACGTGGACTAGATCGCTTCTTTG
TTGATCGTGACAGCCTGCTGGGACTTTTTTCCCTTGTGGTGAGCGGTATC
TACGTTATCTGCTGCATTTTTCTACTGCTGGGAGCAGTTCTGGGCCTGAG
ATATTTTCTGTTGCCTTACCTCTCAGTTTCCTGCCTGCGGTTCTTCATTT
TAGTTGCCGAGGGCGTGTTTGTAGCCACAGAGGGCATCATGAATGAATAT
CTAGTTTTCGATATTCTTCAATCCCTTCTAGGCTTGTACTTTTGGCTGGT
GGTCTACTCCTATTATGATCGCTTAAAGGACGCGTGAGCTTGTAAATTTT
ACAGTATATTGTTAAATATTGGTCCTTATAAAATTTATTCTTTCAATGTT
CTATCATTTTGGATATAAAATAAAGTAATTTATAACCTTTAAAAAAAAAA
AAAAAAA

IP16980.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:14:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34230-RA 563 CG34230-RA 16..555 1..540 2700 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7749117..7749279 376..538 815 100 Plus
chr2R 21145070 chr2R 7748583..7748741 2..160 780 99.4 Plus
chr2R 21145070 chr2R 7748927..7749060 242..375 670 100 Plus
chr2R 21145070 chr2R 7748788..7748874 157..243 435 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:29:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11861845..11862009 376..540 825 100 Plus
2R 25286936 2R 11861310..11861469 1..160 800 100 Plus
2R 25286936 2R 11861655..11861788 242..375 670 100 Plus
2R 25286936 2R 11861516..11861602 157..243 435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11863044..11863208 376..540 825 100 Plus
2R 25260384 2R 11862509..11862668 1..160 800 100 Plus
2R 25260384 2R 11862854..11862987 242..375 670 100 Plus
2R 25260384 2R 11862715..11862801 157..243 435 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:52:01 has no hits.

IP16980.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:52:52 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7748582..7748737 1..156 98 -> Plus
chr2R 7748788..7748873 157..242 100 -> Plus
chr2R 7748928..7749060 243..375 100 -> Plus
chr2R 7749117..7749279 376..540 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:05:28 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:45:42 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:54:50 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:08 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:53:03 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:56:51 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:45:41 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:50 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:08 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:53:03 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 1..540 1..540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:52 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11861310..11861465 1..156 100 -> Plus
2R 11861516..11861601 157..242 100 -> Plus
2R 11861656..11861788 243..375 100 -> Plus
2R 11861845..11862009 376..540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:52 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11861310..11861465 1..156 100 -> Plus
2R 11861516..11861601 157..242 100 -> Plus
2R 11861656..11861788 243..375 100 -> Plus
2R 11861845..11862009 376..540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:52 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11861310..11861465 1..156 100 -> Plus
2R 11861516..11861601 157..242 100 -> Plus
2R 11861656..11861788 243..375 100 -> Plus
2R 11861845..11862009 376..540 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:50 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7749161..7749293 243..375 100 -> Plus
arm_2R 7749350..7749514 376..540 100   Plus
arm_2R 7749021..7749106 157..242 100 -> Plus
arm_2R 7748815..7748970 1..156 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:13 Download gff for IP16980.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11862509..11862664 1..156 100 -> Plus
2R 11862715..11862800 157..242 100 -> Plus
2R 11862855..11862987 243..375 100 -> Plus
2R 11863044..11863208 376..540 100   Plus

IP16980.hyp Sequence

Translation from 2 to 436

> IP16980.hyp
FVSEIGLETPQKETKMIYSDNCCCCVDLKCGSILIAIVEVLIRGLDRFFV
DRDSLLGLFSLVVSGIYVICCIFLLLGAVLGLRYFLLPYLSVSCLRFFIL
VAEGVFVATEGIMNEYLVFDILQSLLGLYFWLVVYSYYDRLKDA*

IP16980.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG34230-PA 129 CG34230-PA 1..129 16..144 667 100 Plus
CG43183-PA 138 CG43183-PA 1..132 16..141 148 27.4 Plus

IP16980.pep Sequence

Translation from 2 to 436

> IP16980.pep
FVSEIGLETPQKETKMIYSDNCCCCVDLKCGSILIAIVEVLIRGLDRFFV
DRDSLLGLFSLVVSGIYVICCIFLLLGAVLGLRYFLLPYLSVSCLRFFIL
VAEGVFVATEGIMNEYLVFDILQSLLGLYFWLVVYSYYDRLKDA*

IP16980.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13101-PA 56 GF13101-PA 1..45 16..63 154 68.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20226-PA 89 GG20226-PA 1..89 16..144 380 65.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24898-PA 135 GH24898-PA 1..111 16..126 257 51.4 Plus
Dgri\GH22906-PA 119 GH22906-PA 1..109 16..124 254 51.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34230-PA 129 CG34230-PA 1..129 16..144 667 100 Plus
CG43183-PA 138 CG43183-PA 1..132 16..141 148 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10089-PA 129 GL10089-PA 1..129 16..144 394 61.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25069-PA 129 GA25069-PA 1..129 16..144 391 61.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21311-PA 80 GM21311-PA 1..80 16..144 323 58.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21468-PA 68 GJ21468-PA 1..65 16..80 196 66.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12386-PA 129 GE12386-PA 1..129 16..144 546 95.3 Plus