IP16980.complete Sequence
557 bp assembled on 2006-11-30
GenBank Submission: BT029596
> IP16980.complete
AGTTCGTATCCGAAATTGGCTTAGAAACCCCCCAAAAAGAAACGAAAATG
ATCTACTCGGACAATTGCTGTTGCTGCGTGGATCTGAAGTGCGGAAGCAT
CCTGATAGCCATCGTTGAGGTGCTAATACGTGGACTAGATCGCTTCTTTG
TTGATCGTGACAGCCTGCTGGGACTTTTTTCCCTTGTGGTGAGCGGTATC
TACGTTATCTGCTGCATTTTTCTACTGCTGGGAGCAGTTCTGGGCCTGAG
ATATTTTCTGTTGCCTTACCTCTCAGTTTCCTGCCTGCGGTTCTTCATTT
TAGTTGCCGAGGGCGTGTTTGTAGCCACAGAGGGCATCATGAATGAATAT
CTAGTTTTCGATATTCTTCAATCCCTTCTAGGCTTGTACTTTTGGCTGGT
GGTCTACTCCTATTATGATCGCTTAAAGGACGCGTGAGCTTGTAAATTTT
ACAGTATATTGTTAAATATTGGTCCTTATAAAATTTATTCTTTCAATGTT
CTATCATTTTGGATATAAAATAAAGTAATTTATAACCTTTAAAAAAAAAA
AAAAAAA
IP16980.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:14:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34230-RA | 563 | CG34230-RA | 16..555 | 1..540 | 2700 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:52:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 7749117..7749279 | 376..538 | 815 | 100 | Plus |
chr2R | 21145070 | chr2R | 7748583..7748741 | 2..160 | 780 | 99.4 | Plus |
chr2R | 21145070 | chr2R | 7748927..7749060 | 242..375 | 670 | 100 | Plus |
chr2R | 21145070 | chr2R | 7748788..7748874 | 157..243 | 435 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:29:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11861845..11862009 | 376..540 | 825 | 100 | Plus |
2R | 25286936 | 2R | 11861310..11861469 | 1..160 | 800 | 100 | Plus |
2R | 25286936 | 2R | 11861655..11861788 | 242..375 | 670 | 100 | Plus |
2R | 25286936 | 2R | 11861516..11861602 | 157..243 | 435 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 11863044..11863208 | 376..540 | 825 | 100 | Plus |
2R | 25260384 | 2R | 11862509..11862668 | 1..160 | 800 | 100 | Plus |
2R | 25260384 | 2R | 11862854..11862987 | 242..375 | 670 | 100 | Plus |
2R | 25260384 | 2R | 11862715..11862801 | 157..243 | 435 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 08:52:01 has no hits.
IP16980.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:52:52 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 7748582..7748737 | 1..156 | 98 | -> | Plus |
chr2R | 7748788..7748873 | 157..242 | 100 | -> | Plus |
chr2R | 7748928..7749060 | 243..375 | 100 | -> | Plus |
chr2R | 7749117..7749279 | 376..540 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:05:28 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..390 | 48..437 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:45:42 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..390 | 48..437 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:54:50 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..390 | 48..437 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:08 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..390 | 48..437 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:53:03 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..390 | 48..437 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:56:51 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..540 | 1..540 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:45:41 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..540 | 1..540 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:50 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..540 | 1..540 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:08 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..540 | 1..540 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:53:03 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34230-RA | 1..540 | 1..540 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:52 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11861310..11861465 | 1..156 | 100 | -> | Plus |
2R | 11861516..11861601 | 157..242 | 100 | -> | Plus |
2R | 11861656..11861788 | 243..375 | 100 | -> | Plus |
2R | 11861845..11862009 | 376..540 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:52 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11861310..11861465 | 1..156 | 100 | -> | Plus |
2R | 11861516..11861601 | 157..242 | 100 | -> | Plus |
2R | 11861656..11861788 | 243..375 | 100 | -> | Plus |
2R | 11861845..11862009 | 376..540 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:52 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11861310..11861465 | 1..156 | 100 | -> | Plus |
2R | 11861516..11861601 | 157..242 | 100 | -> | Plus |
2R | 11861656..11861788 | 243..375 | 100 | -> | Plus |
2R | 11861845..11862009 | 376..540 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:50 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7749161..7749293 | 243..375 | 100 | -> | Plus |
arm_2R | 7749350..7749514 | 376..540 | 100 | | Plus |
arm_2R | 7749021..7749106 | 157..242 | 100 | -> | Plus |
arm_2R | 7748815..7748970 | 1..156 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:13 Download gff for
IP16980.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11862509..11862664 | 1..156 | 100 | -> | Plus |
2R | 11862715..11862800 | 157..242 | 100 | -> | Plus |
2R | 11862855..11862987 | 243..375 | 100 | -> | Plus |
2R | 11863044..11863208 | 376..540 | 100 | | Plus |
IP16980.hyp Sequence
Translation from 2 to 436
> IP16980.hyp
FVSEIGLETPQKETKMIYSDNCCCCVDLKCGSILIAIVEVLIRGLDRFFV
DRDSLLGLFSLVVSGIYVICCIFLLLGAVLGLRYFLLPYLSVSCLRFFIL
VAEGVFVATEGIMNEYLVFDILQSLLGLYFWLVVYSYYDRLKDA*
IP16980.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:27:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34230-PA | 129 | CG34230-PA | 1..129 | 16..144 | 667 | 100 | Plus |
CG43183-PA | 138 | CG43183-PA | 1..132 | 16..141 | 148 | 27.4 | Plus |
IP16980.pep Sequence
Translation from 2 to 436
> IP16980.pep
FVSEIGLETPQKETKMIYSDNCCCCVDLKCGSILIAIVEVLIRGLDRFFV
DRDSLLGLFSLVVSGIYVICCIFLLLGAVLGLRYFLLPYLSVSCLRFFIL
VAEGVFVATEGIMNEYLVFDILQSLLGLYFWLVVYSYYDRLKDA*
IP16980.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:50:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13101-PA | 56 | GF13101-PA | 1..45 | 16..63 | 154 | 68.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:50:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20226-PA | 89 | GG20226-PA | 1..89 | 16..144 | 380 | 65.9 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:50:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH24898-PA | 135 | GH24898-PA | 1..111 | 16..126 | 257 | 51.4 | Plus |
Dgri\GH22906-PA | 119 | GH22906-PA | 1..109 | 16..124 | 254 | 51.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34230-PA | 129 | CG34230-PA | 1..129 | 16..144 | 667 | 100 | Plus |
CG43183-PA | 138 | CG43183-PA | 1..132 | 16..141 | 148 | 27.4 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:50:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10089-PA | 129 | GL10089-PA | 1..129 | 16..144 | 394 | 61.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:50:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25069-PA | 129 | GA25069-PA | 1..129 | 16..144 | 391 | 61.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:50:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21311-PA | 80 | GM21311-PA | 1..80 | 16..144 | 323 | 58.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:50:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ21468-PA | 68 | GJ21468-PA | 1..65 | 16..80 | 196 | 66.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:50:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12386-PA | 129 | GE12386-PA | 1..129 | 16..144 | 546 | 95.3 | Plus |