IP17005.complete Sequence
878 bp assembled on 2006-11-28
GenBank Submission: BT029597
> IP17005.complete
CCAATACACATCTATATACAAACGTATTCTATTTGAGCGTACTTATTTAA
CGAAGAAAATAGATGGTCAGGTCAGCACTATCGTGAGTTTACTGTATGCC
TATAAAAGCAATCCTGCGACTATTAAGGAACCACATGAAACTGTCTCTAA
CGACATTCCTCATTATTCTACATGTTTATCAACATGATAAACTTCACCCA
CGAAACAAGTTCTTTGCTTCTTGGCCTTGCGTGTCCCAGCCGAGTTCCCA
AATTGAACAAACCAGAGAATCAACTTTCTGCCTCGAATAATAAATAAGTC
ATAACCGAGGTGGCTCCTCGCAAACGAAAGGTATGCCAAACTGAACTACT
TGTTGCCATGAAGGAGGAACTGTTGTTTTTCGATTAGTCGGAGTCAGTGC
CACTAACCTAGTGCAACTCGGGTCGTCGTATCTTTTGTTCGGATAAAACT
CCAGGGACTACACATTGGAATTCAAAATCCTTAGATTCAATTAATTCTCA
ATGAATTCAAGTTTCAACAGCGAGCAGTTGGACACCGACCGCGATGGACT
GCAAAAAATTCTGGCCCGATCTCTCAAGGAACCCATTCTTGGCAAGCACT
TTGCCCTGCCTGGCCGCATAGAGCAGAGTCCACCCATCGAACTGGACACC
AGCCAGAGCTACATTGCCGTCTACACTCATCTCAAAGTGCACGCCACCAT
GATGCCGGAGAGATTGCCCACGCCGGAGGCAATCGGACGAATACAGGCGG
AGAACTTGGAGGCAGCGCCCAAGGCACGAAGTTCAAAGACCCGCTTGGAT
CCCTGCTCAAATATAAATTAAATTACGTTGGGCATCAATAAAGAAAGTAT
TGTTATTTTAAAAAAAAAAAAAAAAAAA
IP17005.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:05:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34164-RB | 1747 | CG34164-RB | 889..1747 | 1..859 | 4295 | 100 | Plus |
CG5317-RB | 1795 | CG5317-RB | 937..1795 | 1..859 | 4295 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:02:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 12056070..12056928 | 1..859 | 4295 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:29:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:02:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 12057393..12058252 | 1..860 | 4300 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 12057393..12058252 | 1..860 | 4300 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 21:02:25 has no hits.
IP17005.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:03:33 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 12056070..12056928 | 1..859 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:05:33 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34164-RB | 1..321 | 501..821 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:11 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34164-RB | 1..321 | 501..821 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:39 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34164-RB | 1..321 | 501..821 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:08:47 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34164-RB | 1..321 | 501..821 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:03:02 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34164-RB | 1..321 | 501..821 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:50 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34164-RB | 889..1747 | 1..859 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:11 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34164-RB | 935..1793 | 1..859 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:39 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL7-like-RB | 913..1771 | 1..859 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:08:47 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34164-RB | 889..1747 | 1..859 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:03:02 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL7-like-RB | 913..1771 | 1..859 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:33 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 12057393..12058251 | 1..859 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:33 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 12057393..12058251 | 1..859 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:33 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 12057393..12058251 | 1..859 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:39 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 12057393..12058251 | 1..859 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:56 Download gff for
IP17005.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 12057393..12058251 | 1..859 | 100 | | Plus |
IP17005.hyp Sequence
Translation from 500 to 820
> IP17005.hyp
MNSSFNSEQLDTDRDGLQKILARSLKEPILGKHFALPGRIEQSPPIELDT
SQSYIAVYTHLKVHATMMPERLPTPEAIGRIQAENLEAAPKARSSKTRLD
PCSNIN*
IP17005.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:28:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34164-PC | 106 | CG34164-PC | 1..106 | 1..106 | 541 | 100 | Plus |
CG34164-PB | 106 | CG34164-PB | 1..106 | 1..106 | 541 | 100 | Plus |
WDY-PC | 1069 | CG45799-PC | 942..1010 | 17..85 | 221 | 62.3 | Plus |
IP17005.pep Sequence
Translation from 500 to 820
> IP17005.pep
MNSSFNSEQLDTDRDGLQKILARSLKEPILGKHFALPGRIEQSPPIELDT
SQSYIAVYTHLKVHATMMPERLPTPEAIGRIQAENLEAAPKARSSKTRLD
PCSNIN*
IP17005.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:50:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23761-PA | 106 | GG23761-PA | 1..106 | 1..106 | 493 | 85.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34164-PC | 106 | CG34164-PC | 1..106 | 1..106 | 541 | 100 | Plus |
CG34164-PB | 106 | CG34164-PB | 1..106 | 1..106 | 541 | 100 | Plus |
WDY-PC | 1069 | CG45799-PC | 942..1010 | 17..85 | 221 | 62.3 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:50:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL16195-PA | 643 | GL16195-PA | 506..586 | 6..85 | 229 | 59.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:50:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26717-PA | 106 | GM26717-PA | 1..106 | 1..106 | 518 | 92.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:50:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23813-PA | 106 | GD23813-PA | 1..106 | 1..106 | 517 | 92.5 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:50:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ17315-PA | 909 | GJ17315-PA | 655..728 | 11..85 | 192 | 53.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:50:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK21064-PA | 1068 | GK21064-PA | 941..1009 | 17..85 | 216 | 62.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:50:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18567-PA | 105 | GE18567-PA | 1..105 | 1..105 | 480 | 86.7 | Plus |