Clone IP17005 Report

Search the DGRC for IP17005

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:170
Well:5
Vector:pOT2
Associated Gene/TranscriptCG34164-RB
Protein status:IP17005.pep: gold
Sequenced Size:878

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34164 2008-04-29 Release 5.5 accounting

Clone Sequence Records

IP17005.complete Sequence

878 bp assembled on 2006-11-28

GenBank Submission: BT029597

> IP17005.complete
CCAATACACATCTATATACAAACGTATTCTATTTGAGCGTACTTATTTAA
CGAAGAAAATAGATGGTCAGGTCAGCACTATCGTGAGTTTACTGTATGCC
TATAAAAGCAATCCTGCGACTATTAAGGAACCACATGAAACTGTCTCTAA
CGACATTCCTCATTATTCTACATGTTTATCAACATGATAAACTTCACCCA
CGAAACAAGTTCTTTGCTTCTTGGCCTTGCGTGTCCCAGCCGAGTTCCCA
AATTGAACAAACCAGAGAATCAACTTTCTGCCTCGAATAATAAATAAGTC
ATAACCGAGGTGGCTCCTCGCAAACGAAAGGTATGCCAAACTGAACTACT
TGTTGCCATGAAGGAGGAACTGTTGTTTTTCGATTAGTCGGAGTCAGTGC
CACTAACCTAGTGCAACTCGGGTCGTCGTATCTTTTGTTCGGATAAAACT
CCAGGGACTACACATTGGAATTCAAAATCCTTAGATTCAATTAATTCTCA
ATGAATTCAAGTTTCAACAGCGAGCAGTTGGACACCGACCGCGATGGACT
GCAAAAAATTCTGGCCCGATCTCTCAAGGAACCCATTCTTGGCAAGCACT
TTGCCCTGCCTGGCCGCATAGAGCAGAGTCCACCCATCGAACTGGACACC
AGCCAGAGCTACATTGCCGTCTACACTCATCTCAAAGTGCACGCCACCAT
GATGCCGGAGAGATTGCCCACGCCGGAGGCAATCGGACGAATACAGGCGG
AGAACTTGGAGGCAGCGCCCAAGGCACGAAGTTCAAAGACCCGCTTGGAT
CCCTGCTCAAATATAAATTAAATTACGTTGGGCATCAATAAAGAAAGTAT
TGTTATTTTAAAAAAAAAAAAAAAAAAA

IP17005.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG34164-RB 1747 CG34164-RB 889..1747 1..859 4295 100 Plus
CG5317-RB 1795 CG5317-RB 937..1795 1..859 4295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:02:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12056070..12056928 1..859 4295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:29:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12057393..12058252 1..860 4300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12057393..12058252 1..860 4300 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:02:25 has no hits.

IP17005.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:03:33 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12056070..12056928 1..859 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:05:33 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG34164-RB 1..321 501..821 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:11 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG34164-RB 1..321 501..821 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:39 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG34164-RB 1..321 501..821 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:08:47 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG34164-RB 1..321 501..821 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:03:02 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG34164-RB 1..321 501..821 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:50 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG34164-RB 889..1747 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:11 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG34164-RB 935..1793 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:39 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-like-RB 913..1771 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:08:47 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
CG34164-RB 889..1747 1..859 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:03:02 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
RpL7-like-RB 913..1771 1..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:33 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12057393..12058251 1..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:33 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12057393..12058251 1..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:33 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12057393..12058251 1..859 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:39 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12057393..12058251 1..859 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:56 Download gff for IP17005.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12057393..12058251 1..859 100   Plus

IP17005.hyp Sequence

Translation from 500 to 820

> IP17005.hyp
MNSSFNSEQLDTDRDGLQKILARSLKEPILGKHFALPGRIEQSPPIELDT
SQSYIAVYTHLKVHATMMPERLPTPEAIGRIQAENLEAAPKARSSKTRLD
PCSNIN*

IP17005.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34164-PC 106 CG34164-PC 1..106 1..106 541 100 Plus
CG34164-PB 106 CG34164-PB 1..106 1..106 541 100 Plus
WDY-PC 1069 CG45799-PC 942..1010 17..85 221 62.3 Plus

IP17005.pep Sequence

Translation from 500 to 820

> IP17005.pep
MNSSFNSEQLDTDRDGLQKILARSLKEPILGKHFALPGRIEQSPPIELDT
SQSYIAVYTHLKVHATMMPERLPTPEAIGRIQAENLEAAPKARSSKTRLD
PCSNIN*

IP17005.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23761-PA 106 GG23761-PA 1..106 1..106 493 85.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34164-PC 106 CG34164-PC 1..106 1..106 541 100 Plus
CG34164-PB 106 CG34164-PB 1..106 1..106 541 100 Plus
WDY-PC 1069 CG45799-PC 942..1010 17..85 221 62.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16195-PA 643 GL16195-PA 506..586 6..85 229 59.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26717-PA 106 GM26717-PA 1..106 1..106 518 92.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23813-PA 106 GD23813-PA 1..106 1..106 517 92.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17315-PA 909 GJ17315-PA 655..728 11..85 192 53.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21064-PA 1068 GK21064-PA 941..1009 17..85 216 62.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18567-PA 105 GE18567-PA 1..105 1..105 480 86.7 Plus