Clone IP17135 Report

Search the DGRC for IP17135

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:171
Well:35
Vector:pOT2
Associated Gene/TranscriptCG34183-RA
Protein status:IP17135.pep: gold
Sequenced Size:525

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34183 2008-04-29 Release 5.5 accounting
CG34183 2008-08-15 Release 5.9 accounting
CG34183 2008-12-18 5.12 accounting

Clone Sequence Records

IP17135.complete Sequence

525 bp assembled on 2006-11-28

GenBank Submission: BT029627

> IP17135.complete
AAAATGACTACAGAAAAAGGGGAGCAGTTGAGACAACAACTTATAGCGGC
GGTGGTAAAGAAACGAGCGGCGATTGCGAGAGCCCATGAAATCGTGGTGC
GGCTTTTGGAGCCCGGAATACCGGAGCCCGAGTTCCTGTCCCTGCTCTGT
GAGATTGGCCCCCCAAATTATTCAGACATAGTGGATGAGCGGGAAATAAA
CAAACTTTGTGGATATCCACTTTGTTCGACAGTTCTAGAAAACGTTCCCA
AGCAAAAGTACAGTATCTCCGCTTCCAAAAACAAAGTATACGACATCACA
GAACGCAAGAAATTCTGTTCCGGATACTGTTTTAAGGCCTCCGAATATAT
TAAGTCACAGGTGCCCACATCGCCATTGTGGCTGCGAGATAGGGAGACGA
GACCTAGCTTTCAGCTGCTACCACGAAATACTTGACCAACGATATACATA
GCTCTCAAAGCGTTTATATTTATTTCGTATAAGCATTAAGACCATTTCTT
CATTAAAAAAAAAAAAAAAAAAAAA

IP17135.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34183-RA 583 CG34183-RA 47..551 1..505 2465 99.2 Plus
FKBP59-RA 1631 FKBP59-RA 1536..1631 505..410 465 98.9 Minus
FKBP59.a 1733 FKBP59.a 1638..1733 505..410 465 98.9 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9888981..9889242 504..243 1295 99.6 Minus
chr2L 23010047 chr2L 9889462..9889575 144..31 570 100 Minus
chr2L 23010047 chr2L 9889306..9889404 242..144 480 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9890060..9890322 505..243 1285 99.2 Minus
2L 23513712 2L 9890542..9890655 144..31 555 99.1 Minus
2L 23513712 2L 9890386..9890484 242..144 480 99 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9890060..9890322 505..243 1285 99.2 Minus
2L 23513712 2L 9890542..9890655 144..31 555 99.1 Minus
2L 23513712 2L 9890386..9890484 242..144 480 98.9 Minus
2L 23513712 2L 9890712..9890743 32..1 160 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:11:03 has no hits.

IP17135.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:11:48 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9888981..9889242 243..504 99 <- Minus
chr2L 9889306..9889403 145..242 98 <- Minus
chr2L 9889462..9889573 33..144 100 <- Minus
chr2L 9889632..9889663 1..32 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:08 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 1..432 4..435 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:21 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 1..432 4..435 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:53 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 1..432 4..435 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:51 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 1..432 4..435 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:19 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 1..432 4..435 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:54 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 45..548 1..504 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:21 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 45..548 1..504 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:53 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 30..533 1..504 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:51 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 45..548 1..504 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:19 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
CG34183-RA 30..533 1..504 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:48 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890542..9890653 33..144 99 <- Minus
2L 9890712..9890743 1..32 100   Minus
2L 9890061..9890322 243..504 99 <- Minus
2L 9890386..9890483 145..242 98 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:48 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890542..9890653 33..144 99 <- Minus
2L 9890712..9890743 1..32 100   Minus
2L 9890061..9890322 243..504 99 <- Minus
2L 9890386..9890483 145..242 98 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:48 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890542..9890653 33..144 99 <- Minus
2L 9890712..9890743 1..32 100   Minus
2L 9890061..9890322 243..504 99 <- Minus
2L 9890386..9890483 145..242 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:53 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9890061..9890322 243..504 99 <- Minus
arm_2L 9890386..9890483 145..242 98 <- Minus
arm_2L 9890542..9890653 33..144 99 <- Minus
arm_2L 9890712..9890743 1..32 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:41 Download gff for IP17135.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890061..9890322 243..504 99 <- Minus
2L 9890386..9890483 145..242 98 <- Minus
2L 9890542..9890653 33..144 99 <- Minus
2L 9890712..9890743 1..32 100   Minus

IP17135.hyp Sequence

Translation from 0 to 434

> IP17135.hyp
KMTTEKGEQLRQQLIAAVVKKRAAIARAHEIVVRLLEPGIPEPEFLSLLC
EIGPPNYSDIVDEREINKLCGYPLCSTVLENVPKQKYSISASKNKVYDIT
ERKKFCSGYCFKASEYIKSQVPTSPLWLRDRETRPSFQLLPRNT*

IP17135.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34183-PA 143 CG34183-PA 1..143 2..144 744 100 Plus

IP17135.pep Sequence

Translation from 0 to 434

> IP17135.pep
KMTTEKGEQLRQQLIAAVVKKRAAIARAHEIVVRLLEPGIPEPEFLSLLC
EIGPPNYSDIVDEREINKLCGYPLCSTVLENVPKQKYSISASKNKVYDIT
ERKKFCSGYCFKASEYIKSQVPTSPLWLRDRETRPSFQLLPRNT*

IP17135.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15235-PA 80 GF15235-PA 1..79 2..80 367 88.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24003-PA 143 GG24003-PA 1..143 2..144 737 97.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34183-PA 143 CG34183-PA 1..143 2..144 744 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24388-PA 148 GI24388-PA 1..141 2..142 558 72.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19204-PA 143 GL19204-PA 1..142 2..143 618 81 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25874-PA 143 GA25874-PA 1..142 2..143 626 81.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12222-PA 166 GM12222-PA 1..80 2..81 425 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22332-PA 143 GD22332-PA 1..143 2..144 743 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21647-PA 147 GJ21647-PA 1..141 2..142 571 74.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23863-PA 140 GK23863-PA 1..139 2..140 544 73.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10281-PA 73 GE10281-PA 10..73 81..144 316 90.6 Plus