Clone IP17178 Report

Search the DGRC for IP17178

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:171
Well:78
Vector:pOT2
Associated Gene/TranscriptCG34222-RA
Protein status:IP17178.pep: gold
Sequenced Size:577

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34222 2008-04-29 Release 5.5 accounting
CG34222 2008-08-15 Release 5.9 accounting
CG34222 2008-12-18 5.12 accounting

Clone Sequence Records

IP17178.complete Sequence

577 bp assembled on 2006-11-28

GenBank Submission: BT029639

> IP17178.complete
CAAATTTTCAGCTTGCTGATCAATTAAACGGGATGCGTCATACCCAGAAG
GTGCTGACAAGGCTGTGCCGTTTATCCGCCGGAGGACTTAGACAGAAATG
CCGATCCTTCAACCAACAAAACTTTAAGCCCAGCATAGCCGACGAGGCTA
ACAAGCGCCCAACGCACTTTCAGTCCATGCGCGAATTCTTTATGCATCCG
CTGACCTGGGACCGCAATAACGGCTATTTCAATGTGGTTCTGGCTTTGTC
CATTTTCGGATTCTGCTTCTTCAATTCCTGCGCCCCGTGTGAACAGAAGA
GGGGTGGCCTTGAGGAGCGAACCAACCGCCCGCAGTGAAACCGGTGGGCT
ATCCTCGAATCTTCTCAAACTCACCCTGATTGCAGACGCAGACGAGCCCG
GAATTGGTCGAACGGCACTGAGCATTCATGTCGCACAAGGTCGGGTTGTT
CAGACAGTTCTGCTCCTCGATGCACACGTATCCATCTCCCTTGAAACCAG
CGATGCACTGGCACTCGTAATTGGCCGGATCCCTATAAATATATCAGCAG
AAATGTATTAAAAAAAAAAAAAAAAAA

IP17178.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG34222-RA 609 CG34222-RA 51..609 1..559 2795 100 Plus
Ndg-RB 4886 Ndg-RB 3392..3550 532..374 795 100 Minus
Ndg-RA 4997 Ndg-RA 3466..3624 532..374 795 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6207322..6207851 559..30 2620 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10319842..10320373 561..30 2660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10321041..10321572 561..30 2660 100 Minus
2R 25260384 2R 10321644..10321674 31..1 155 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:20:37 has no hits.

IP17178.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:21:25 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6207322..6207850 31..559 99 <- Minus
chr2R 6207924..6207953 1..30 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:27 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:17:44 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:08:37 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:28:49 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:11 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 1..306 33..338 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:46:11 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 26..584 1..559 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:17:44 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 26..584 1..559 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:08:37 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 26..584 1..559 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:28:50 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 26..584 1..559 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:11 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
CG34222-RA 26..584 1..559 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:25 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10319844..10320372 31..559 100 <- Minus
2R 10320446..10320475 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:25 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10319844..10320372 31..559 100 <- Minus
2R 10320446..10320475 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:25 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10319844..10320372 31..559 100 <- Minus
2R 10320446..10320475 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:08:37 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6207349..6207877 31..559 100 <- Minus
arm_2R 6207951..6207980 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:47:41 Download gff for IP17178.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10321043..10321571 31..559 100 <- Minus
2R 10321645..10321674 1..30 100   Minus

IP17178.hyp Sequence

Translation from 2 to 337

> IP17178.hyp
NFQLADQLNGMRHTQKVLTRLCRLSAGGLRQKCRSFNQQNFKPSIADEAN
KRPTHFQSMREFFMHPLTWDRNNGYFNVVLALSIFGFCFFNSCAPCEQKR
GGLEERTNRPQ*

IP17178.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34222-PA 101 CG34222-PA 1..101 11..111 554 100 Plus

IP17178.pep Sequence

Translation from 2 to 337

> IP17178.pep
NFQLADQLNGMRHTQKVLTRLCRLSAGGLRQKCRSFNQQNFKPSIADEAN
KRPTHFQSMREFFMHPLTWDRNNGYFNVVLALSIFGFCFFNSCAPCEQKR
GGLEERTNRPQ*

IP17178.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG34222-PA 101 CG34222-PA 1..101 11..111 554 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20205-PA 112 GI20205-PA 48..102 46..100 216 65.5 Plus