IP17193.complete Sequence
384 bp assembled on 2006-11-28
GenBank Submission: BT029643.1
> IP17193.complete
TCAGCTAAAATATTCCATATTTTAGCTAAATGGCAGTCCTGCGTGGTTGG
AGATTCGTTGGATTCGTGTCCTGCATCGTGGGCGCCGTGGGCCTCACCCT
ATACCCCGTCATTGTGGACCCCATGGTTAACACTGAGAAATACAAAACCC
TGCAGGAATACAGCAAAATCAAGAGAGATGAACTGCAGCACATTAAAAGG
CAGTAGAACCCCCTGTTATGCTACACTTAAGAACCCAAATATGTGTATTC
TAGTTTGCCTGATAAAGAACTGCAATGTACAAATTGCTATTAAAATAGAA
ACTATTTGTACCCTGACAGCATGAACTCCATGAATTAAACTGTTACCTAT
ACATGCAGGAAAATCCAAAAAAAAAAAAAAAAAA
IP17193.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:49:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34242-RA | 366 | CG34242-RA | 1..366 | 1..366 | 1830 | 100 | Plus |
CG34242-RB | 385 | CG34242-RB | 23..368 | 24..369 | 1730 | 100 | Plus |
Tsf2.a | 3515 | Tsf2.a | 67..217 | 151..1 | 755 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:03:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 12524640..12525005 | 1..366 | 1800 | 99.5 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:03:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 12534038..12534406 | 1..369 | 1845 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 12527138..12527506 | 1..369 | 1845 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-17 00:03:18 has no hits.
IP17193.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:04:25 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 12524640..12525005 | 1..366 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:32 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RB | 1..177 | 30..206 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:58 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RB | 1..177 | 30..206 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:28:28 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 1..177 | 30..206 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:41 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 1..177 | 30..206 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:08:19 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 1..177 | 30..206 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:51 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 1..366 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:58 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 1..366 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:28:28 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 1..366 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:41 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 1..366 | 1..366 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:08:19 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 1..366 | 1..366 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:25 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12534038..12534403 | 1..366 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:25 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12534038..12534403 | 1..366 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:25 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12534038..12534403 | 1..366 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:28:28 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 12527138..12527503 | 1..366 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:45 Download gff for
IP17193.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12527138..12527503 | 1..366 | 100 | | Plus |
IP17193.hyp Sequence
Translation from 0 to 323
> IP17193.hyp
SAKIFHILAKWQSCVVGDSLDSCPASWAPWASPYTPSLWTPWLTLRNTKP
CRNTAKSREMNCSTLKGSRTPCYATLKNPNMCILVCLIKNCNVQIAIKIE
TICTLTA*
Sequence IP17193.hyp has no blast hits.
IP17193.pep Sequence
Translation from 29 to 205
> IP17193.pep
MAVLRGWRFVGFVSCIVGAVGLTLYPVIVDPMVNTEKYKTLQEYSKIKRD
ELQHIKRQ*
IP17193.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:31:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24685-PA | 58 | GF24685-PA | 1..56 | 1..56 | 284 | 92.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:31:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15581-PA | 58 | GG15581-PA | 1..58 | 1..58 | 298 | 94.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34242-PB | 58 | CG34242-PB | 1..58 | 1..58 | 301 | 100 | Plus |
CG34242-PA | 58 | CG34242-PA | 1..58 | 1..58 | 301 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:31:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25198-PA | 60 | GL25198-PA | 1..59 | 1..58 | 266 | 83.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:31:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA23724-PA | 60 | GA23724-PA | 1..59 | 1..58 | 266 | 83.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:31:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25352-PA | 58 | GM25352-PA | 1..58 | 1..58 | 306 | 100 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:31:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14385-PA | 58 | GD14385-PA | 1..58 | 1..58 | 303 | 98.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:31:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK13281-PA | 58 | GK13281-PA | 1..54 | 1..54 | 271 | 88.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:31:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21910-PA | 58 | GE21910-PA | 1..58 | 1..58 | 296 | 93.1 | Plus |