Clone IP17193 Report

Search the DGRC for IP17193

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:171
Well:93
Vector:pOT2
Associated Gene/TranscriptCG34242-RA
Protein status:IP17193.pep: gold
Sequenced Size:384

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34242 2008-04-29 Release 5.5 accounting
CG34242 2008-08-15 Release 5.9 accounting
CG34242 2008-12-18 5.12 accounting

Clone Sequence Records

IP17193.complete Sequence

384 bp assembled on 2006-11-28

GenBank Submission: BT029643.1

> IP17193.complete
TCAGCTAAAATATTCCATATTTTAGCTAAATGGCAGTCCTGCGTGGTTGG
AGATTCGTTGGATTCGTGTCCTGCATCGTGGGCGCCGTGGGCCTCACCCT
ATACCCCGTCATTGTGGACCCCATGGTTAACACTGAGAAATACAAAACCC
TGCAGGAATACAGCAAAATCAAGAGAGATGAACTGCAGCACATTAAAAGG
CAGTAGAACCCCCTGTTATGCTACACTTAAGAACCCAAATATGTGTATTC
TAGTTTGCCTGATAAAGAACTGCAATGTACAAATTGCTATTAAAATAGAA
ACTATTTGTACCCTGACAGCATGAACTCCATGAATTAAACTGTTACCTAT
ACATGCAGGAAAATCCAAAAAAAAAAAAAAAAAA

IP17193.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34242-RA 366 CG34242-RA 1..366 1..366 1830 100 Plus
CG34242-RB 385 CG34242-RB 23..368 24..369 1730 100 Plus
Tsf2.a 3515 Tsf2.a 67..217 151..1 755 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12524640..12525005 1..366 1800 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12534038..12534406 1..369 1845 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12527138..12527506 1..369 1845 100 Plus
Blast to na_te.dros performed on 2019-03-17 00:03:18 has no hits.

IP17193.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:04:25 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12524640..12525005 1..366 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:32 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RB 1..177 30..206 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:58 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RB 1..177 30..206 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:28:28 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 1..177 30..206 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:41 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 1..177 30..206 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:08:19 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 1..177 30..206 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:51 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 1..366 1..366 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:58 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 1..366 1..366 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:28:28 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 1..366 1..366 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:41 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 1..366 1..366 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:08:19 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 1..366 1..366 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:25 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12534038..12534403 1..366 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:25 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12534038..12534403 1..366 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:25 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12534038..12534403 1..366 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:28:28 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12527138..12527503 1..366 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:45 Download gff for IP17193.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12527138..12527503 1..366 100   Plus

IP17193.hyp Sequence

Translation from 0 to 323

> IP17193.hyp
SAKIFHILAKWQSCVVGDSLDSCPASWAPWASPYTPSLWTPWLTLRNTKP
CRNTAKSREMNCSTLKGSRTPCYATLKNPNMCILVCLIKNCNVQIAIKIE
TICTLTA*
Sequence IP17193.hyp has no blast hits.

IP17193.pep Sequence

Translation from 29 to 205

> IP17193.pep
MAVLRGWRFVGFVSCIVGAVGLTLYPVIVDPMVNTEKYKTLQEYSKIKRD
ELQHIKRQ*

IP17193.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24685-PA 58 GF24685-PA 1..56 1..56 284 92.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15581-PA 58 GG15581-PA 1..58 1..58 298 94.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34242-PB 58 CG34242-PB 1..58 1..58 301 100 Plus
CG34242-PA 58 CG34242-PA 1..58 1..58 301 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25198-PA 60 GL25198-PA 1..59 1..58 266 83.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23724-PA 60 GA23724-PA 1..59 1..58 266 83.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25352-PA 58 GM25352-PA 1..58 1..58 306 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14385-PA 58 GD14385-PA 1..58 1..58 303 98.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13281-PA 58 GK13281-PA 1..54 1..54 271 88.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21910-PA 58 GE21910-PA 1..58 1..58 296 93.1 Plus