BDGP Sequence Production Resources |
Search the DGRC for IP17207
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 172 |
Well: | 7 |
Vector: | pOT2 |
Associated Gene/Transcript | Blos3-RA |
Protein status: | IP17207.pep: gold |
Sequenced Size: | 505 |
Gene | Date | Evidence |
---|---|---|
CG34255 | 2008-04-29 | Release 5.5 accounting |
CG34255 | 2008-08-15 | Release 5.9 accounting |
CG34255 | 2008-12-18 | 5.12 accounting |
505 bp assembled on 2006-11-28
GenBank Submission: BT029644
> IP17207.complete ACTGAATGATGGCTGATTTGGTGAGCGGTGAAGCTTCTGAATCCGACGAG GAGCTGCAGGAGAAGAATAAGATTTTTGCTGCTGAAATTTCGGGCGAAGC CTCCGAAGAGGATGATGAAGACATTTACGAGCAAGGCCGAAGCAGCAACC AGGTCAACAGCACGGCTTCCATTTACCGGAATAATCTGCTTCAGCGGAAA CTAATCGAAAACAACATTGCCATTTGGAGATCCCTTACCGCTTTCACTCG CAGCTTTGTGTTGAGTGCATCAAAGCAGCTCGTAACCACTGATCAAATGC TCATCAAGTCGCAACATAGTCTTCAGTCGGCTCACACATCCCTGCAGCAG GCCCAGAAGAACGCCCAGGACCTGCAAAACAGGGTGGCTGATGTTATTAC CAGCAACTTCCTCCCGCACATAAGCATCCAGAAGGCAACCTGACTTAGAC GTATAGTGTATTTGCTGATAAACGATCAAATCTAGGCTAAAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 18860223..18860506 | 205..488 | 1405 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 18860035..18860169 | 70..204 | 675 | 100 | Plus |
chr3L | 24539361 | chr3L | 18859909..18859986 | 1..78 | 360 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 18863714..18863999 | 205..490 | 1430 | 100 | Plus |
3L | 28103327 | 3L | 18863526..18863660 | 70..204 | 675 | 100 | Plus |
3L | 28103327 | 3L | 18863400..18863477 | 1..78 | 360 | 97.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18859909..18859979 | 1..71 | 100 | -> | Plus |
chr3L | 18860037..18860169 | 72..204 | 100 | -> | Plus |
chr3L | 18860223..18860506 | 205..488 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34255-RA | 1..435 | 9..443 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
blos3-RA | 1..435 | 9..443 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
blos3-RA | 1..435 | 9..443 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34255-RA | 1..435 | 9..443 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Blos3-RA | 1..435 | 9..443 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34255-RA | 47..534 | 1..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
blos3-RA | 47..534 | 1..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
blos3-RA | 77..564 | 1..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34255-RA | 47..534 | 1..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Blos3-RA | 77..564 | 1..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18870300..18870370 | 1..71 | 100 | -> | Plus |
3L | 18870428..18870560 | 72..204 | 100 | -> | Plus |
3L | 18870614..18870897 | 205..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18870300..18870370 | 1..71 | 100 | -> | Plus |
3L | 18870428..18870560 | 72..204 | 100 | -> | Plus |
3L | 18870614..18870897 | 205..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18870300..18870370 | 1..71 | 100 | -> | Plus |
3L | 18870428..18870560 | 72..204 | 100 | -> | Plus |
3L | 18870614..18870897 | 205..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18863400..18863470 | 1..71 | 100 | -> | Plus |
arm_3L | 18863528..18863660 | 72..204 | 100 | -> | Plus |
arm_3L | 18863714..18863997 | 205..488 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18863400..18863470 | 1..71 | 100 | -> | Plus |
3L | 18863528..18863660 | 72..204 | 100 | -> | Plus |
3L | 18863714..18863997 | 205..488 | 100 | Plus |
Translation from 5 to 442
> IP17207.pep MMADLVSGEASESDEELQEKNKIFAAEISGEASEEDDEDIYEQGRSSNQV NSTASIYRNNLLQRKLIENNIAIWRSLTAFTRSFVLSASKQLVTTDQMLI KSQHSLQSAHTSLQQAQKNAQDLQNRVADVITSNFLPHISIQKAT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23645-PA | 73 | GF23645-PA | 1..66 | 2..66 | 228 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16010-PA | 145 | GG16010-PA | 1..145 | 2..145 | 627 | 89 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14598-PA | 142 | GH14598-PA | 1..138 | 2..143 | 467 | 66.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Blos3-PA | 144 | CG34255-PA | 1..144 | 2..145 | 703 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13484-PA | 136 | GI13484-PA | 1..133 | 2..143 | 477 | 68.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21438-PA | 275 | GL21438-PA | 197..275 | 63..144 | 224 | 59 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23545-PA | 146 | GA23545-PA | 1..146 | 2..144 | 492 | 71.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14999-PA | 144 | GM14999-PA | 1..143 | 2..144 | 684 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14777-PA | 144 | GD14777-PA | 1..144 | 2..145 | 693 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11845-PA | 125 | GJ11845-PA | 5..123 | 23..144 | 436 | 70.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20441-PA | 151 | GK20441-PA | 1..149 | 2..142 | 451 | 67.8 | Plus |
Translation from 5 to 442
> IP17207.hyp MMADLVSGEASESDEELQEKNKIFAAEISGEASEEDDEDIYEQGRSSNQV NSTASIYRNNLLQRKLIENNIAIWRSLTAFTRSFVLSASKQLVTTDQMLI KSQHSLQSAHTSLQQAQKNAQDLQNRVADVITSNFLPHISIQKAT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Blos3-PA | 144 | CG34255-PA | 1..144 | 2..145 | 703 | 100 | Plus |