Clone IP17207 Report

Search the DGRC for IP17207

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:172
Well:7
Vector:pOT2
Associated Gene/TranscriptBlos3-RA
Protein status:IP17207.pep: gold
Sequenced Size:505

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34255 2008-04-29 Release 5.5 accounting
CG34255 2008-08-15 Release 5.9 accounting
CG34255 2008-12-18 5.12 accounting

Clone Sequence Records

IP17207.complete Sequence

505 bp assembled on 2006-11-28

GenBank Submission: BT029644

> IP17207.complete
ACTGAATGATGGCTGATTTGGTGAGCGGTGAAGCTTCTGAATCCGACGAG
GAGCTGCAGGAGAAGAATAAGATTTTTGCTGCTGAAATTTCGGGCGAAGC
CTCCGAAGAGGATGATGAAGACATTTACGAGCAAGGCCGAAGCAGCAACC
AGGTCAACAGCACGGCTTCCATTTACCGGAATAATCTGCTTCAGCGGAAA
CTAATCGAAAACAACATTGCCATTTGGAGATCCCTTACCGCTTTCACTCG
CAGCTTTGTGTTGAGTGCATCAAAGCAGCTCGTAACCACTGATCAAATGC
TCATCAAGTCGCAACATAGTCTTCAGTCGGCTCACACATCCCTGCAGCAG
GCCCAGAAGAACGCCCAGGACCTGCAAAACAGGGTGGCTGATGTTATTAC
CAGCAACTTCCTCCCGCACATAAGCATCCAGAAGGCAACCTGACTTAGAC
GTATAGTGTATTTGCTGATAAACGATCAAATCTAGGCTAAAAAAAAAAAA
AAAAA

IP17207.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34255-RA 560 CG34255-RA 47..536 1..490 2450 100 Plus
Rad9-RA 1791 Rad9-RA 1348..1482 373..239 675 100 Minus
Rad9-RA 1791 Rad9-RA 1482..1535 54..1 270 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18860223..18860506 205..488 1405 99.6 Plus
chr3L 24539361 chr3L 18860035..18860169 70..204 675 100 Plus
chr3L 24539361 chr3L 18859909..18859986 1..78 360 97.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18870614..18870899 205..490 1430 100 Plus
3L 28110227 3L 18870426..18870560 70..204 675 100 Plus
3L 28110227 3L 18870300..18870377 1..78 360 97.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18863714..18863999 205..490 1430 100 Plus
3L 28103327 3L 18863526..18863660 70..204 675 100 Plus
3L 28103327 3L 18863400..18863477 1..78 360 97.4 Plus
Blast to na_te.dros performed on 2019-03-15 23:11:13 has no hits.

IP17207.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:11:54 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18859909..18859979 1..71 100 -> Plus
chr3L 18860037..18860169 72..204 100 -> Plus
chr3L 18860223..18860506 205..488 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:34 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
CG34255-RA 1..435 9..443 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:17:25 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
blos3-RA 1..435 9..443 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:07 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
blos3-RA 1..435 9..443 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:28:24 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
CG34255-RA 1..435 9..443 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:31 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
Blos3-RA 1..435 9..443 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:45:54 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
CG34255-RA 47..534 1..488 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:17:24 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
blos3-RA 47..534 1..488 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:07 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
blos3-RA 77..564 1..488 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:28:24 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
CG34255-RA 47..534 1..488 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:31 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
Blos3-RA 77..564 1..488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:54 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18870300..18870370 1..71 100 -> Plus
3L 18870428..18870560 72..204 100 -> Plus
3L 18870614..18870897 205..488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:54 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18870300..18870370 1..71 100 -> Plus
3L 18870428..18870560 72..204 100 -> Plus
3L 18870614..18870897 205..488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:54 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18870300..18870370 1..71 100 -> Plus
3L 18870428..18870560 72..204 100 -> Plus
3L 18870614..18870897 205..488 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:07 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18863400..18863470 1..71 100 -> Plus
arm_3L 18863528..18863660 72..204 100 -> Plus
arm_3L 18863714..18863997 205..488 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:47:26 Download gff for IP17207.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18863400..18863470 1..71 100 -> Plus
3L 18863528..18863660 72..204 100 -> Plus
3L 18863714..18863997 205..488 100   Plus

IP17207.pep Sequence

Translation from 5 to 442

> IP17207.pep
MMADLVSGEASESDEELQEKNKIFAAEISGEASEEDDEDIYEQGRSSNQV
NSTASIYRNNLLQRKLIENNIAIWRSLTAFTRSFVLSASKQLVTTDQMLI
KSQHSLQSAHTSLQQAQKNAQDLQNRVADVITSNFLPHISIQKAT*

IP17207.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23645-PA 73 GF23645-PA 1..66 2..66 228 83.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16010-PA 145 GG16010-PA 1..145 2..145 627 89 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14598-PA 142 GH14598-PA 1..138 2..143 467 66.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Blos3-PA 144 CG34255-PA 1..144 2..145 703 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13484-PA 136 GI13484-PA 1..133 2..143 477 68.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21438-PA 275 GL21438-PA 197..275 63..144 224 59 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23545-PA 146 GA23545-PA 1..146 2..144 492 71.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14999-PA 144 GM14999-PA 1..143 2..144 684 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14777-PA 144 GD14777-PA 1..144 2..145 693 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11845-PA 125 GJ11845-PA 5..123 23..144 436 70.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20441-PA 151 GK20441-PA 1..149 2..142 451 67.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19571-PA 145 GE19571-PA 1..145 2..145 638 91 Plus
Dyak\GE23087-PA 145 GE23087-PA 1..145 2..145 638 91 Plus

IP17207.hyp Sequence

Translation from 5 to 442

> IP17207.hyp
MMADLVSGEASESDEELQEKNKIFAAEISGEASEEDDEDIYEQGRSSNQV
NSTASIYRNNLLQRKLIENNIAIWRSLTAFTRSFVLSASKQLVTTDQMLI
KSQHSLQSAHTSLQQAQKNAQDLQNRVADVITSNFLPHISIQKAT*

IP17207.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
Blos3-PA 144 CG34255-PA 1..144 2..145 703 100 Plus