IP17217.complete Sequence
371 bp assembled on 2006-11-29
GenBank Submission: BT029646
> IP17217.complete
CAAGTGACAATATCTCCAAGTCAAGTTTGTAAATTACTAAGAAAATACCA
AAATGTTCCGCATTATCGCTGTGATCTTCGCCCTGGTAGCAATGGCTTTT
GCTGCTCCTGGTTACATTGAGCCCTCCTACGGAGTGGTTCCTGTAGCCCA
AGTGGTGCCCGTGGTGAAATCTGTTCCAGTGGTGCAGCACGTTCCGGTGG
TGAAGAATGTCCCAGTGGTTCAGCATGTCCCTGTGCTGAAGTCCTACGCT
GTTCCCACCTATGGACACCACATCTACCACGGTTAAATTTTGGAAAGAGC
TCAATCGATATCGCACGGGAATAAATAAAATGTTTATGCTTGTAAAAAAA
AAAAAAAAAAAAAAAAAAAAA
IP17217.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:10:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-RA | 471 | CG34267-RA | 103..449 | 1..347 | 1720 | 99.7 | Plus |
CG34268-RA | 476 | CG34268-RA | 109..302 | 42..235 | 730 | 91.7 | Plus |
CG34268-RA | 476 | CG34268-RA | 246..374 | 161..289 | 555 | 95.3 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:11:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 499882..500160 | 343..65 | 1380 | 99.6 | Minus |
chr3L | 24539361 | chr3L | 500962..501204 | 65..289 | 820 | 90.1 | Plus |
chr3L | 24539361 | chr3L | 500224..500287 | 64..1 | 320 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:11:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 500016..500298 | 347..65 | 1400 | 99.6 | Minus |
3L | 28110227 | 3L | 501100..501342 | 65..289 | 820 | 90.1 | Plus |
3L | 28110227 | 3L | 500362..500425 | 64..1 | 320 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 500016..500298 | 347..65 | 1400 | 99.6 | Minus |
3L | 28103327 | 3L | 501100..501270 | 65..235 | 615 | 90.6 | Plus |
3L | 28103327 | 3L | 501214..501342 | 161..289 | 555 | 95.3 | Plus |
3L | 28103327 | 3L | 500362..500425 | 64..1 | 320 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 10:11:10 has no hits.
IP17217.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:12:05 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 499882..500160 | 65..343 | 99 | <- | Minus |
chr3L | 500224..500287 | 1..64 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:36 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 1..234 | 53..286 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:16:11 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 1..234 | 53..286 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:30 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 1..234 | 53..286 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:26:45 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 1..234 | 53..286 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:58:54 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 1..234 | 53..286 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:44:45 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 22..338 | 1..317 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:16:11 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 22..338 | 1..317 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:30 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 27..369 | 1..343 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:26:45 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 22..338 | 1..317 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:58:54 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 27..369 | 1..343 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:05 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 500020..500298 | 65..343 | 99 | <- | Minus |
3L | 500362..500425 | 1..64 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:05 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 500020..500298 | 65..343 | 99 | <- | Minus |
3L | 500362..500425 | 1..64 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:05 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 500020..500298 | 65..343 | 99 | <- | Minus |
3L | 500362..500425 | 1..64 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:30 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 500020..500298 | 65..343 | 99 | <- | Minus |
arm_3L | 500362..500425 | 1..64 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:46:33 Download gff for
IP17217.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 500020..500298 | 65..343 | 99 | <- | Minus |
3L | 500362..500425 | 1..64 | 100 | | Minus |
IP17217.hyp Sequence
Translation from 52 to 285
> IP17217.hyp
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVQHVPVV
KNVPVVQHVPVLKSYAVPTYGHHIYHG*
IP17217.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:34:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-PA | 77 | CG34267-PA | 1..77 | 1..77 | 397 | 100 | Plus |
CG34268-PA | 83 | CG34268-PA | 1..83 | 1..77 | 380 | 92.8 | Plus |
IP17217.pep Sequence
Translation from 52 to 285
> IP17217.pep
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVQHVPVV
KNVPVVQHVPVLKSYAVPTYGHHIYHG*
IP17217.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:52:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14724-PA | 92 | GG14724-PA | 1..92 | 1..77 | 148 | 57.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-PA | 77 | CG34267-PA | 1..77 | 1..77 | 397 | 100 | Plus |
CG34268-PA | 83 | CG34268-PA | 1..83 | 1..77 | 380 | 92.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:52:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14341-PA | 83 | GM14341-PA | 1..83 | 1..77 | 170 | 86.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:52:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD11017-PA | 83 | GD11017-PA | 1..83 | 1..77 | 170 | 86.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:52:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21086-PA | 77 | GE21086-PA | 1..77 | 1..77 | 171 | 87 | Plus |