Clone IP17217 Report

Search the DGRC for IP17217

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:172
Well:17
Vector:pOT2
Associated Gene/TranscriptCG34267-RA
Protein status:IP17217.pep: gold
Sequenced Size:371

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34267 2008-04-29 Release 5.5 accounting
CG34267 2008-08-15 Release 5.9 accounting
CG34267 2008-12-18 5.12 accounting

Clone Sequence Records

IP17217.complete Sequence

371 bp assembled on 2006-11-29

GenBank Submission: BT029646

> IP17217.complete
CAAGTGACAATATCTCCAAGTCAAGTTTGTAAATTACTAAGAAAATACCA
AAATGTTCCGCATTATCGCTGTGATCTTCGCCCTGGTAGCAATGGCTTTT
GCTGCTCCTGGTTACATTGAGCCCTCCTACGGAGTGGTTCCTGTAGCCCA
AGTGGTGCCCGTGGTGAAATCTGTTCCAGTGGTGCAGCACGTTCCGGTGG
TGAAGAATGTCCCAGTGGTTCAGCATGTCCCTGTGCTGAAGTCCTACGCT
GTTCCCACCTATGGACACCACATCTACCACGGTTAAATTTTGGAAAGAGC
TCAATCGATATCGCACGGGAATAAATAAAATGTTTATGCTTGTAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

IP17217.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-RA 471 CG34267-RA 103..449 1..347 1720 99.7 Plus
CG34268-RA 476 CG34268-RA 109..302 42..235 730 91.7 Plus
CG34268-RA 476 CG34268-RA 246..374 161..289 555 95.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 499882..500160 343..65 1380 99.6 Minus
chr3L 24539361 chr3L 500962..501204 65..289 820 90.1 Plus
chr3L 24539361 chr3L 500224..500287 64..1 320 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 500016..500298 347..65 1400 99.6 Minus
3L 28110227 3L 501100..501342 65..289 820 90.1 Plus
3L 28110227 3L 500362..500425 64..1 320 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 500016..500298 347..65 1400 99.6 Minus
3L 28103327 3L 501100..501270 65..235 615 90.6 Plus
3L 28103327 3L 501214..501342 161..289 555 95.3 Plus
3L 28103327 3L 500362..500425 64..1 320 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:11:10 has no hits.

IP17217.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:12:05 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 499882..500160 65..343 99 <- Minus
chr3L 500224..500287 1..64 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:36 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 1..234 53..286 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:16:11 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 1..234 53..286 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:30 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 1..234 53..286 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:26:45 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 1..234 53..286 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:58:54 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 1..234 53..286 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:44:45 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 22..338 1..317 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:16:11 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 22..338 1..317 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:30 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 27..369 1..343 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:26:45 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 22..338 1..317 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:58:54 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 27..369 1..343 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:05 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
3L 500020..500298 65..343 99 <- Minus
3L 500362..500425 1..64 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:05 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
3L 500020..500298 65..343 99 <- Minus
3L 500362..500425 1..64 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:05 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
3L 500020..500298 65..343 99 <- Minus
3L 500362..500425 1..64 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:30 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 500020..500298 65..343 99 <- Minus
arm_3L 500362..500425 1..64 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:46:33 Download gff for IP17217.complete
Subject Subject Range Query Range Percent Splice Strand
3L 500020..500298 65..343 99 <- Minus
3L 500362..500425 1..64 100   Minus

IP17217.hyp Sequence

Translation from 52 to 285

> IP17217.hyp
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVQHVPVV
KNVPVVQHVPVLKSYAVPTYGHHIYHG*

IP17217.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-PA 77 CG34267-PA 1..77 1..77 397 100 Plus
CG34268-PA 83 CG34268-PA 1..83 1..77 380 92.8 Plus

IP17217.pep Sequence

Translation from 52 to 285

> IP17217.pep
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVQHVPVV
KNVPVVQHVPVLKSYAVPTYGHHIYHG*

IP17217.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14724-PA 92 GG14724-PA 1..92 1..77 148 57.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-PA 77 CG34267-PA 1..77 1..77 397 100 Plus
CG34268-PA 83 CG34268-PA 1..83 1..77 380 92.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14341-PA 83 GM14341-PA 1..83 1..77 170 86.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11017-PA 83 GD11017-PA 1..83 1..77 170 86.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21086-PA 77 GE21086-PA 1..77 1..77 171 87 Plus