IP17237.complete Sequence
550 bp assembled on 2006-11-30
GenBank Submission: BT029653
> IP17237.complete
AACAATTGCTGTCGCACACTACGAATCTATTGAGGGACACGCGGTTAGGG
GCCGCATGCTGCGTTCTTGGTCTTTTTAAAGATGCCAAGTCATTGGCCAT
GTCTTTTGATCCTGCTTGTTGTAATCGTACTCATCCTAGCTGTTTGCGGA
TACTACACAATTATTCACCCGAAACAGATTCATCTGGAAAGCTGTTTTCT
CAAAGGCGGGGCCTGCCGGGAAACGTGGAACTGCGACGAAAGGTACCGCA
GTCGCGTTCGCACCACGTGTATCAACAAACGAAAGGTCTGCTGCATGCCC
ACGCTCCAGATAAAGAGCATTCAGGATGCCGAGTACTACATCGAGTGAAG
GTCCTTTGGATTGGAGACTCCCCAAGTTGAAAAAGCAGGACACGCCACTC
TAATTACACACCATATCTTGTATTGAATGTATCATTTCGTAGGCAATTTA
TTACAATGGAATAATGAAGTTAAATTAGTATTCCGGAAACAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
IP17237.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:04:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34286-RA | 835 | CG34286-RA | 163..649 | 1..487 | 2420 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:14:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 15539247..15539552 | 487..182 | 1530 | 100 | Minus |
chr3R | 27901430 | chr3R | 15539609..15539789 | 181..1 | 890 | 99.4 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 19715372..19715677 | 487..182 | 1530 | 100 | Minus |
3R | 32079331 | 3R | 19715734..19715914 | 181..1 | 890 | 99.4 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 19456203..19456508 | 487..182 | 1530 | 100 | Minus |
3R | 31820162 | 3R | 19456565..19456745 | 181..1 | 890 | 99.4 | Minus |
Blast to na_te.dros performed on 2019-03-16 04:14:38 has no hits.
IP17237.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:15:37 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 15539243..15539552 | 182..490 | 99 | <- | Minus |
chr3R | 15539609..15539789 | 1..181 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:45 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 1..267 | 82..348 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:17 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 1..267 | 82..348 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:37 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 1..267 | 82..348 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:46 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 1..267 | 82..348 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:35 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 1..267 | 82..348 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:45 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 14..501 | 1..490 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:17 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 14..501 | 1..490 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:37 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 14..501 | 1..490 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:46 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 14..501 | 1..490 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:35 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 14..501 | 1..490 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:37 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19715368..19715677 | 182..490 | 99 | <- | Minus |
3R | 19715734..19715914 | 1..181 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:37 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19715368..19715677 | 182..490 | 99 | <- | Minus |
3R | 19715734..19715914 | 1..181 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:37 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19715368..19715677 | 182..490 | 99 | <- | Minus |
3R | 19715734..19715914 | 1..181 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:37 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 15541456..15541636 | 1..181 | 99 | | Minus |
arm_3R | 15541090..15541399 | 182..490 | 99 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:39 Download gff for
IP17237.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19456565..19456745 | 1..181 | 99 | | Minus |
3R | 19456199..19456508 | 182..490 | 99 | <- | Minus |
IP17237.hyp Sequence
Translation from 2 to 379
> IP17237.hyp
QLLSHTTKLLRDTRLGAACCVLGLFKDAKSLAMSFDPACCNRTHPSCLRI
LHNYSPETDSSGKLFSQRRGLPGNVELRRKVPQSRSHHVYQQTKGLLHAH
APDKEHSGCRVLHRVKVLWIGDSPS*
Sequence IP17237.hyp has no blast hits.
IP17237.pep Sequence
Translation from 81 to 347
> IP17237.pep
MPSHWPCLLILLVVIVLILAVCGYYTIIHPKQIHLESCFLKGGACRETWN
CDERYRSRVRTTCINKRKVCCMPTLQIKSIQDAEYYIE*
IP17237.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:18:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15864-PA | 88 | GG15864-PA | 1..88 | 1..88 | 329 | 76.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34286-PB | 88 | CG34286-PB | 1..88 | 1..88 | 487 | 100 | Plus |
CG34286-PA | 88 | CG34286-PA | 1..88 | 1..88 | 487 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:18:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11950-PA | 87 | GL11950-PA | 12..76 | 9..73 | 171 | 41.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:18:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA26142-PA | 87 | GA26142-PA | 12..76 | 9..73 | 171 | 41.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:18:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26896-PA | 88 | GM26896-PA | 1..88 | 1..88 | 371 | 89.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:18:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20103-PA | 88 | GD20103-PA | 1..88 | 1..88 | 371 | 89.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:18:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25116-PA | 88 | GE25116-PA | 1..88 | 1..88 | 355 | 83 | Plus |