Clone IP17237 Report

Search the DGRC for IP17237

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:172
Well:37
Vector:pOT2
Associated Gene/TranscriptCG34286-RA
Protein status:IP17237.pep: gold
Sequenced Size:550

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34286 2008-04-29 Release 5.5 accounting
CG34286 2008-08-15 Release 5.9 accounting
CG34286 2008-12-18 5.12 accounting

Clone Sequence Records

IP17237.complete Sequence

550 bp assembled on 2006-11-30

GenBank Submission: BT029653

> IP17237.complete
AACAATTGCTGTCGCACACTACGAATCTATTGAGGGACACGCGGTTAGGG
GCCGCATGCTGCGTTCTTGGTCTTTTTAAAGATGCCAAGTCATTGGCCAT
GTCTTTTGATCCTGCTTGTTGTAATCGTACTCATCCTAGCTGTTTGCGGA
TACTACACAATTATTCACCCGAAACAGATTCATCTGGAAAGCTGTTTTCT
CAAAGGCGGGGCCTGCCGGGAAACGTGGAACTGCGACGAAAGGTACCGCA
GTCGCGTTCGCACCACGTGTATCAACAAACGAAAGGTCTGCTGCATGCCC
ACGCTCCAGATAAAGAGCATTCAGGATGCCGAGTACTACATCGAGTGAAG
GTCCTTTGGATTGGAGACTCCCCAAGTTGAAAAAGCAGGACACGCCACTC
TAATTACACACCATATCTTGTATTGAATGTATCATTTCGTAGGCAATTTA
TTACAATGGAATAATGAAGTTAAATTAGTATTCCGGAAACAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP17237.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34286-RA 835 CG34286-RA 163..649 1..487 2420 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15539247..15539552 487..182 1530 100 Minus
chr3R 27901430 chr3R 15539609..15539789 181..1 890 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19715372..19715677 487..182 1530 100 Minus
3R 32079331 3R 19715734..19715914 181..1 890 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19456203..19456508 487..182 1530 100 Minus
3R 31820162 3R 19456565..19456745 181..1 890 99.4 Minus
Blast to na_te.dros performed on 2019-03-16 04:14:38 has no hits.

IP17237.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:15:37 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15539243..15539552 182..490 99 <- Minus
chr3R 15539609..15539789 1..181 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:45 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 1..267 82..348 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:17 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 1..267 82..348 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:37 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 1..267 82..348 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:46 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 1..267 82..348 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:35 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 1..267 82..348 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:45 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 14..501 1..490 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:17 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 14..501 1..490 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:37 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 14..501 1..490 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:46 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 14..501 1..490 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:35 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 14..501 1..490 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:37 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19715368..19715677 182..490 99 <- Minus
3R 19715734..19715914 1..181 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:37 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19715368..19715677 182..490 99 <- Minus
3R 19715734..19715914 1..181 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:37 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19715368..19715677 182..490 99 <- Minus
3R 19715734..19715914 1..181 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:37 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15541456..15541636 1..181 99   Minus
arm_3R 15541090..15541399 182..490 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:39 Download gff for IP17237.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19456565..19456745 1..181 99   Minus
3R 19456199..19456508 182..490 99 <- Minus

IP17237.hyp Sequence

Translation from 2 to 379

> IP17237.hyp
QLLSHTTKLLRDTRLGAACCVLGLFKDAKSLAMSFDPACCNRTHPSCLRI
LHNYSPETDSSGKLFSQRRGLPGNVELRRKVPQSRSHHVYQQTKGLLHAH
APDKEHSGCRVLHRVKVLWIGDSPS*
Sequence IP17237.hyp has no blast hits.

IP17237.pep Sequence

Translation from 81 to 347

> IP17237.pep
MPSHWPCLLILLVVIVLILAVCGYYTIIHPKQIHLESCFLKGGACRETWN
CDERYRSRVRTTCINKRKVCCMPTLQIKSIQDAEYYIE*

IP17237.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15864-PA 88 GG15864-PA 1..88 1..88 329 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34286-PB 88 CG34286-PB 1..88 1..88 487 100 Plus
CG34286-PA 88 CG34286-PA 1..88 1..88 487 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11950-PA 87 GL11950-PA 12..76 9..73 171 41.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26142-PA 87 GA26142-PA 12..76 9..73 171 41.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26896-PA 88 GM26896-PA 1..88 1..88 371 89.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20103-PA 88 GD20103-PA 1..88 1..88 371 89.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25116-PA 88 GE25116-PA 1..88 1..88 355 83 Plus