Clone IP17243 Report

Search the DGRC for IP17243

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:172
Well:43
Vector:pOT2
Associated Gene/TranscriptCG34149-RA
Protein status:IP17243.pep: gold
Sequenced Size:1092

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34149 2008-04-29 Release 5.5 accounting
CG34149 2008-08-15 Release 5.9 accounting
CG34149 2008-12-18 5.12 accounting

Clone Sequence Records

IP17243.complete Sequence

1092 bp assembled on 2006-11-28

GenBank Submission: BT029657

> IP17243.complete
CACAACAAACCCATTGTAAACAACTTCGAAAAGACGAAAATGAGCTTCTC
GGAAAACACCTCCGATTCTGAATGGAAGACAGACAAAATGCTAAAGGCGC
GGACTGCTAAGAAATCTTTAAAGCTGGACAAGGAGCACAGAACTCTGAAA
CCTAAATATAACCAGAAGTTCTGCGAAAAGTGGCTCAAGATTTTCGATCC
ATGGCTCCGACGGGCGGCCGAGGATCCTAACAAGCCATTCTGCCGCGCTT
GCCAGTGCACCATGGACTGCAATCGATGCCACCTGGTGCGGCACGAGCGA
ACCACCAAGCACAAGCGCAATCTGGAGGCTCTGCTCACAAAGGGCGAAGG
CGCGGCGGTCCAGGAGTTCCGGATTCGCCAGCAGCGTAGCAAGTACTATC
ACCAGCGTAAATTGGTAGTGATGGAGCCCTTGGCTGAGAACCACGAGTTG
GAGCCGCCTTCCACTCCAGAGCCTATGCCCGTGATGGCCATTGCTGATCA
AAGCCTCTGTTCTGCAGCCAGTGAGAAGGTGACAGTACCCAAACAGGAGT
TCTTATCAGAGACAGAGGTCACAACAAAGATGACCGAACCCCCGTCAAGC
CATGCCAATTGCAGTGACAGCTCCTCTTCTGCCTCTAAGCAGGAGGGCAT
AAAGTTACTAATGCAGATCCACCAGGACAAAAACGAACTCATGGAATCCT
TCCGCGAGCTGATGGGAAGCCAGAGGACCCTAAGTCACACACCGCCGCCC
AAGGAGAAGAATCATGTGGATCTGTTTTTCGAAAGCGTCAGTTCCAGCGT
GAAAGCCCTCTCGCCAAAGTTGGTAGCGGAAGCCAAGATGCGAGTATCGC
AGCTGATCTGTGAGCTCGAGCTTCGCGGCCTCAGTGAAACCAGCCAAACG
GACGCACTGAATCCAAACCCTCAAGCTAATGAATCGCTCGCACTGCGCCC
ATCATGACAATCCCTTGTCCTTCAGCATGAATTTAGAGGCATACATTAAT
TTTAAATTTAAAAATAAATGTTATCGATTTTTATAAGATCAATGCAAATA
TACTTTATTTGTTAGATATACGAAAAAAAAAAAAAAAAAAAA

IP17243.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG34149-RB 1079 CG34149-RB 8..1079 1..1072 5360 100 Plus
CG34149-RA 1079 CG34149-RA 8..1079 1..1072 5360 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18203807..18204805 74..1072 4905 99.4 Plus
chr3R 27901430 chr3R 18203680..18203754 1..75 360 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22380255..22381255 74..1074 5005 100 Plus
3R 32079331 3R 22380128..22380202 1..75 375 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22121086..22122086 74..1074 5005 100 Plus
3R 31820162 3R 22120959..22121033 1..75 375 100 Plus
Blast to na_te.dros performed 2019-03-16 19:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 1444..1526 977..1057 122 62.7 Plus
jockey2 3428 jockey2 JOCKEY2 3428bp 1313..1361 985..1036 118 73.1 Plus
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 1362..1429 979..1049 114 66.7 Plus

IP17243.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:57:02 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18203680..18203753 1..74 98 -> Plus
chr3R 18203808..18204805 75..1072 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:51 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RB 1..918 40..957 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:16:36 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RB 1..918 40..957 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:22 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RA 1..918 40..957 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:28:14 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RB 1..918 40..957 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:46:46 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RA 1..918 40..957 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:45:46 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:16:36 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:22 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:28:14 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RA 1..1072 1..1072 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:46:46 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
CG34149-RA 1..1072 1..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:57:02 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22380128..22380201 1..74 100 -> Plus
3R 22380256..22381253 75..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:57:02 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22380128..22380201 1..74 100 -> Plus
3R 22380256..22381253 75..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:57:02 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22380128..22380201 1..74 100 -> Plus
3R 22380256..22381253 75..1072 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:22 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18205850..18205923 1..74 100 -> Plus
arm_3R 18205978..18206975 75..1072 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:46:52 Download gff for IP17243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22120959..22121032 1..74 100 -> Plus
3R 22121087..22122084 75..1072 100   Plus

IP17243.hyp Sequence

Translation from 0 to 956

> IP17243.hyp
HNKPIVNNFEKTKMSFSENTSDSEWKTDKMLKARTAKKSLKLDKEHRTLK
PKYNQKFCEKWLKIFDPWLRRAAEDPNKPFCRACQCTMDCNRCHLVRHER
TTKHKRNLEALLTKGEGAAVQEFRIRQQRSKYYHQRKLVVMEPLAENHEL
EPPSTPEPMPVMAIADQSLCSAASEKVTVPKQEFLSETEVTTKMTEPPSS
HANCSDSSSSASKQEGIKLLMQIHQDKNELMESFRELMGSQRTLSHTPPP
KEKNHVDLFFESVSSSVKALSPKLVAEAKMRVSQLICELELRGLSETSQT
DALNPNPQANESLALRPS*

IP17243.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34149-PB 305 CG34149-PB 1..305 14..318 1590 100 Plus
CG34149-PA 305 CG34149-PA 1..305 14..318 1590 100 Plus
CG43342-PA 180 CG31169-PA 56..151 209..296 154 42.3 Plus

IP17243.pep Sequence

Translation from 0 to 956

> IP17243.pep
HNKPIVNNFEKTKMSFSENTSDSEWKTDKMLKARTAKKSLKLDKEHRTLK
PKYNQKFCEKWLKIFDPWLRRAAEDPNKPFCRACQCTMDCNRCHLVRHER
TTKHKRNLEALLTKGEGAAVQEFRIRQQRSKYYHQRKLVVMEPLAENHEL
EPPSTPEPMPVMAIADQSLCSAASEKVTVPKQEFLSETEVTTKMTEPPSS
HANCSDSSSSASKQEGIKLLMQIHQDKNELMESFRELMGSQRTLSHTPPP
KEKNHVDLFFESVSSSVKALSPKLVAEAKMRVSQLICELELRGLSETSQT
DALNPNPQANESLALRPS*

IP17243.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18441-PA 327 GF18441-PA 1..308 14..316 878 60.3 Plus
Dana\GF18442-PA 168 GF18442-PA 92..144 247..302 142 53.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11126-PA 304 GG11126-PA 1..304 14..318 1419 88.5 Plus
Dere\GG11127-PA 180 GG11127-PA 62..152 214..296 150 42.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20362-PA 184 GH20362-PA 50..151 193..298 365 74.5 Plus
Dgri\GH13311-PA 184 GH13311-PA 50..151 193..298 365 74.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34149-PB 305 CG34149-PB 1..305 14..318 1590 100 Plus
CG34149-PA 305 CG34149-PA 1..305 14..318 1590 100 Plus
CG43342-PA 180 CG31169-PA 56..151 209..296 154 42.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22379-PA 148 GI22379-PA 18..107 218..295 141 38.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24205-PA 357 GL24205-PA 1..318 14..298 823 55.9 Plus
Dper\GL24206-PA 191 GL24206-PA 60..150 218..296 155 41.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26535-PA 357 GA26535-PA 1..318 14..298 853 57.1 Plus
Dpse\GA16060-PB 1628 GA16060-PB 61..150 219..296 152 42.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20942-PA 122 GD20942-PA 7..92 218..295 144 43.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24410-PA 323 GJ24410-PA 6..300 36..312 769 56 Plus
Dvir\GJ24412-PA 143 GJ24412-PA 19..105 219..296 149 41.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14263-PA 299 GK14263-PA 1..272 14..301 666 50.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10293-PA 180 GE10293-PA 66..152 218..296 146 43.2 Plus