Clone IP17254 Report

Search the DGRC for IP17254

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:172
Well:54
Vector:pOT2
Associated Gene/TranscriptCG34294-RA
Protein status:IP17254.pep: wuzgold
Sequenced Size:926

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34294 2008-04-29 Release 5.5 accounting
CG34294 2008-08-15 Release 5.9 accounting
CG34294 2008-12-18 5.12 accounting

Clone Sequence Records

IP17254.complete Sequence

926 bp assembled on 2006-11-28

GenBank Submission: BT029658

> IP17254.complete
AATAACACGTATAAGCATATTTTTACTATTAATTTGTATCTTATTAGTCA
AGCGCATCATTCTCACGATTTATTTACACCCTGTTACAAAATGTAAGAAC
AATGGCAAAATTTAAGCAAATAAACAAACAAAAAAAACGTTTTTTTCATT
TACCAAATCTCGGCGTTGTTGCACTTAGTATTTGAACTCCAACAGAGCCA
CCTTATCGTATCGGTATTGAGATAGACAATCAAATCAAGTATTGGAGATA
CCCACAAGTATCTTATTTGGCAAAGCCACGCCCACGCCGCCGCAAGCGTT
TCAACAAAGCCACGCACGAGCACACATCCTCTACTGCCCCATTGGATGCA
TTGGTAATCGAAACATAAATAAATTTGATCAAGCAAATTGTAAGTCGCCA
TCTCCTCAATCGAGCTATGACAACTATTTTGCATCACTCCTGCTCCTCCA
GCGAGTCCGAGCCGATTGTCTCTAAACACCTCTCTTTCGATTCCCGCAGT
ATTGGAAGGCACCGCGCATCCAGCGGGCCACCACACTCACCTCGTCCATG
TCCCTGCCGGCGGAGTGCCTGGTTCTCTCCGTATCCATGCCCTCGCTCAA
CTCGGAGCCCAAGCGTCCCAAGAGCGCGGGACCCAAGAAGAAGCCCGGCC
AGGCCGTCCACTCGAAGCCATTCCGCCTATATTGAGCCTGTCGAGGAAGG
AGCTGCTCCACAAGTCGCACGTGACGTCACCCAATCGAAGCACTCAGAGA
TTTGTGCACAAGTTGATATCGAGGCACGCACTTCTAAAACATGCATATGC
AGAATACATTTTATCAAACCGTTGATTGTTTAGAACCGAAATGGAAACGA
AACTTGGCATTTACAACATAACAATAAACGACTAAATGAGAGGCAAAGTT
AAGCACAAAAAAAAAAAAAAAAAAAA

IP17254.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34294-RA 911 CG34294-RA 2..911 1..910 4550 100 Plus
tau-RA 2392 tau-RA 2257..2392 1..136 680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23462799..23463704 906..1 4485 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:30:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27639886..27640795 910..1 4550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:00:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27380717..27381626 910..1 4550 100 Minus
Blast to na_te.dros performed 2019-03-17 00:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
mdg3 5519 mdg3 DMMDG3 5519bp Derived from X95908 (e990667) (Rel. 49, Last updated, Version 3). 1007..1079 415..340 138 68.4 Minus

IP17254.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:04:30 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23462799..23463704 1..906 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:53 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
CG34294-RA 1..417 417..833 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:31:40 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
CG34294-RA 1..417 417..833 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:28:37 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
CG34294-RA 1..417 417..833 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:05:23 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
CG34294-RA 1..417 417..833 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:08:29 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
tau-RF 1024..1212 497..685 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:33:01 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
CG34294-RA 2..907 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:31:40 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
CG34294-RA 2..907 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:28:37 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
CG34294-RA 1..906 1..906 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:05:24 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
CG34294-RA 2..907 1..906 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:08:29 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
tau-RF 1389..1798 497..906 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:30 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27639890..27640795 1..906 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:30 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27639890..27640795 1..906 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:30 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27639890..27640795 1..906 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:28:37 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23465612..23466517 1..906 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:43:32 Download gff for IP17254.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27380721..27381626 1..906 100   Minus

IP17254.hyp Sequence

Translation from 416 to 832

> IP17254.hyp
MTTILHHSCSSSESEPIVSKHLSFDSRSIGRHRASSGPPHSPRPCPCRRS
AWFSPYPCPRSTRSPSVPRARDPRRSPARPSTRSHSAYIEPVEEGAAPQV
ARDVTQSKHSEICAQVDIEARTSKTCICRIHFIKPLIV*
Sequence IP17254.hyp has no blast hits.

IP17254.pep Sequence

Translation from 416 to 832

> IP17254.pep
MTTILHHSCSSSESEPIVSKHLSFDSRSIGRHRASSGPPHSPRPCPCRRS
AWFSPYPCPRSTRSPSVPRARDPRRSPARPSTRSHSAYIEPVEEGAAPQV
ARDVTQSKHSEICAQVDIEARTSKTCICRIHFIKPLIV*
Sequence IP17254.pep has no blast hits.