IP17304.complete Sequence
282 bp assembled on 2006-11-28
GenBank Submission: BT029662
> IP17304.complete
TTGATCCGATATTAGTGCATTAATGGACTGCTGCGGTAACGAAGTGCGCA
GCGAAAGTATCCACAACATGCTACAGGCCCTGGTGGACTCAAAGGTGGTC
AACGTGCAGCTTTTGTCGATTGCCGTGGGCATTTTCTTCGTGGTCATGCT
GCTGAAAAACAATTTTCGCAGCTTTTCTGTCACGTAGATGGATCCAGTTT
AGTGTTTAATATATCTCATAATGTAATGTACGCTAAGGATTAATAATAAC
TACCACAAGCCACAAAAAAAAAAAAAAAAAAA
IP17304.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:11:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34250-RA | 263 | CG34250-RA | 1..263 | 1..263 | 1315 | 100 | Plus |
CG34250.a | 599 | CG34250.a | 1..183 | 1..183 | 915 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:47:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 17465809..17466071 | 1..263 | 1315 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 17476289..17476551 | 1..263 | 1315 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 17469389..17469651 | 1..263 | 1315 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 20:47:32 has no hits.
IP17304.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:48:33 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 17465809..17466071 | 1..263 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:59 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 1..165 | 23..187 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:17:28 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 1..165 | 23..187 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:21:00 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 1..165 | 23..187 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:28:28 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 1..165 | 23..187 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:37 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 1..165 | 23..187 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:45:58 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 1..263 | 1..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:17:28 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 1..263 | 1..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:21:00 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 68..330 | 1..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:28:28 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 1..263 | 1..263 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:37 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34250-RA | 68..330 | 1..263 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:33 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17476289..17476551 | 1..263 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:33 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17476289..17476551 | 1..263 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:33 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17476289..17476551 | 1..263 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:00 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 17469389..17469651 | 1..263 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:47:30 Download gff for
IP17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 17469389..17469651 | 1..263 | 100 | | Plus |
IP17304.hyp Sequence
Translation from 22 to 186
> IP17304.hyp
MDCCGNEVRSESIHNMLQALVDSKVVNVQLLSIAVGIFFVVMLLKNNFRS
FSVT*
IP17304.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:36:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34250-PA | 54 | CG34250-PA | 1..54 | 1..54 | 268 | 100 | Plus |
CG34250-PB | 72 | CG34250-PB | 1..54 | 1..54 | 268 | 100 | Plus |
IP17304.pep Sequence
Translation from 22 to 186
> IP17304.pep
MDCCGNEVRSESIHNMLQALVDSKVVNVQLLSIAVGIFFVVMLLKNNFRS
FSVT*
IP17304.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:07:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10535-PA | 54 | GF10535-PA | 1..54 | 1..54 | 249 | 90.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:07:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13619-PA | 54 | GG13619-PA | 1..54 | 1..54 | 255 | 94.4 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:07:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH16189-PA | 54 | GH16189-PA | 1..54 | 1..54 | 240 | 85.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34250-PA | 54 | CG34250-PA | 1..54 | 1..54 | 268 | 100 | Plus |
CG34250-PB | 72 | CG34250-PB | 1..54 | 1..54 | 268 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:07:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25703-PA | 54 | GM25703-PA | 1..54 | 1..54 | 260 | 94.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:07:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14710-PA | 54 | GD14710-PA | 1..54 | 1..54 | 260 | 94.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:07:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19916-PA | 54 | GE19916-PA | 1..54 | 1..54 | 255 | 94.4 | Plus |