Clone IP17304 Report

Search the DGRC for IP17304

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:173
Well:4
Vector:pOT2
Associated Gene/TranscriptCG34250-RA
Protein status:IP17304.pep: gold
Sequenced Size:282

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34250 2008-04-29 Release 5.5 accounting
CG34250 2008-08-15 Release 5.9 accounting
CG34250 2008-12-18 5.12 accounting

Clone Sequence Records

IP17304.complete Sequence

282 bp assembled on 2006-11-28

GenBank Submission: BT029662

> IP17304.complete
TTGATCCGATATTAGTGCATTAATGGACTGCTGCGGTAACGAAGTGCGCA
GCGAAAGTATCCACAACATGCTACAGGCCCTGGTGGACTCAAAGGTGGTC
AACGTGCAGCTTTTGTCGATTGCCGTGGGCATTTTCTTCGTGGTCATGCT
GCTGAAAAACAATTTTCGCAGCTTTTCTGTCACGTAGATGGATCCAGTTT
AGTGTTTAATATATCTCATAATGTAATGTACGCTAAGGATTAATAATAAC
TACCACAAGCCACAAAAAAAAAAAAAAAAAAA

IP17304.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG34250-RA 263 CG34250-RA 1..263 1..263 1315 100 Plus
CG34250.a 599 CG34250.a 1..183 1..183 915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17465809..17466071 1..263 1315 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17476289..17476551 1..263 1315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17469389..17469651 1..263 1315 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:47:32 has no hits.

IP17304.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:48:33 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17465809..17466071 1..263 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:06:59 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 1..165 23..187 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:17:28 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 1..165 23..187 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:21:00 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 1..165 23..187 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:28:28 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 1..165 23..187 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:37 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 1..165 23..187 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:45:58 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 1..263 1..263 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:17:28 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 1..263 1..263 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:21:00 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 68..330 1..263 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:28:28 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 1..263 1..263 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:37 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
CG34250-RA 68..330 1..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:33 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17476289..17476551 1..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:33 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17476289..17476551 1..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:33 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17476289..17476551 1..263 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:00 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17469389..17469651 1..263 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:47:30 Download gff for IP17304.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17469389..17469651 1..263 100   Plus

IP17304.hyp Sequence

Translation from 22 to 186

> IP17304.hyp
MDCCGNEVRSESIHNMLQALVDSKVVNVQLLSIAVGIFFVVMLLKNNFRS
FSVT*

IP17304.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG34250-PA 54 CG34250-PA 1..54 1..54 268 100 Plus
CG34250-PB 72 CG34250-PB 1..54 1..54 268 100 Plus

IP17304.pep Sequence

Translation from 22 to 186

> IP17304.pep
MDCCGNEVRSESIHNMLQALVDSKVVNVQLLSIAVGIFFVVMLLKNNFRS
FSVT*

IP17304.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10535-PA 54 GF10535-PA 1..54 1..54 249 90.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13619-PA 54 GG13619-PA 1..54 1..54 255 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16189-PA 54 GH16189-PA 1..54 1..54 240 85.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34250-PA 54 CG34250-PA 1..54 1..54 268 100 Plus
CG34250-PB 72 CG34250-PB 1..54 1..54 268 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25703-PA 54 GM25703-PA 1..54 1..54 260 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14710-PA 54 GD14710-PA 1..54 1..54 260 94.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19916-PA 54 GE19916-PA 1..54 1..54 255 94.4 Plus