Clone IP17319 Report

Search the DGRC for IP17319

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:173
Well:19
Vector:pOT2
Associated Gene/TranscriptCpr65Ay-RA
Protein status:IP17319.pep: gold
Sequenced Size:459

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cpr65Ay 2008-04-29 Release 5.5 accounting
Cpr65Ay 2008-08-15 Release 5.9 accounting
Cpr65Ay 2008-12-18 5.12 accounting

Clone Sequence Records

IP17319.complete Sequence

459 bp assembled on 2006-11-29

GenBank Submission: BT029667

> IP17319.complete
AAGAACGTAGGGTTCTGATCACAAATATATTCTAATTTTGCCCTTGTTAA
AACGCTATAATGGCAATGAAATTGCTAAGCCAAGTGTTTTTAATAACTGC
GTTAATTGCTTTGGTTTCATCGGCTTCCTTGGAGAAAGGTGAGCGAGAGG
AGAAGCTTCATTTCGGATTTCACACCGAAAATGGTCACCAGAGAAATGAG
GCCATAACGTACACAGTAAAGCCGGAAACAGTTCAGGATCCCAAGGAGGT
GACAACCCAAAAACCTGTAGAATATAAAGGTGGATACAGCTTCATCTCAG
CCGATGGTTACGAGTACCAGGTCCTCTATAAAGCCAACAAAAACGGTTTT
CAGCCCTATGTGACAGCCCACAAAATTAAACCGGATAAGAGTTAAGCCAT
TTTATTGTATTGTGATAGAAAAATAAAATTCCGCAAAGTTAAAAAAAAAA
AAAAAAAAA

IP17319.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ay-RA 504 Cpr65Ay-RA 56..495 1..440 2200 100 Plus
Cpr65Ay.a 504 Cpr65Ay.a 56..495 1..440 2200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6150632..6150906 440..166 1315 98.5 Minus
chr3L 24539361 chr3L 6150962..6151054 166..74 465 100 Minus
chr3L 24539361 chr3L 6151108..6151186 79..1 365 97.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6158075..6158349 440..166 1375 100 Minus
3L 28110227 3L 6158405..6158497 166..74 465 100 Minus
3L 28110227 3L 6158551..6158629 79..1 380 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6151175..6151449 440..166 1375 100 Minus
3L 28103327 3L 6151505..6151597 166..74 465 100 Minus
3L 28103327 3L 6151651..6151729 79..1 380 98.7 Minus
Blast to na_te.dros performed on 2019-03-15 20:47:42 has no hits.

IP17319.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:48:39 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6150632..6150905 167..440 98 <- Minus
chr3L 6150962..6151053 75..166 100 <- Minus
chr3L 6151113..6151186 1..74 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:05 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:15:56 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:21:11 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:26:34 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:50 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 1..330 66..395 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:44:35 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 2..441 1..440 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:15:56 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 2..441 1..440 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:21:11 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 2..441 1..440 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:26:34 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 2..441 1..440 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:50 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Ay-RA 2..441 1..440 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:39 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6158075..6158348 167..440 100 <- Minus
3L 6158405..6158496 75..166 100 <- Minus
3L 6158556..6158629 1..74 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:39 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6158075..6158348 167..440 100 <- Minus
3L 6158405..6158496 75..166 100 <- Minus
3L 6158556..6158629 1..74 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:48:39 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6158075..6158348 167..440 100 <- Minus
3L 6158405..6158496 75..166 100 <- Minus
3L 6158556..6158629 1..74 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:11 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6151175..6151448 167..440 100 <- Minus
arm_3L 6151505..6151596 75..166 100 <- Minus
arm_3L 6151656..6151729 1..74 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:46:23 Download gff for IP17319.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6151175..6151448 167..440 100 <- Minus
3L 6151505..6151596 75..166 100 <- Minus
3L 6151656..6151729 1..74 100   Minus

IP17319.hyp Sequence

Translation from 59 to 394

> IP17319.hyp
MAMKLLSQVFLITALIALVSSASLEKGEREEKLHFGFHTENGHQRNEAIT
YTVKPETVQDPKEVTTQKPVEYKGGYSFISADGYEYQVLYKANKNGFQPY
VTAHKIKPDKS*

IP17319.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ay-PA 109 CG34271-PA 1..109 3..111 565 100 Plus

IP17319.pep Sequence

Translation from 59 to 394

> IP17319.pep
MAMKLLSQVFLITALIALVSSASLEKGEREEKLHFGFHTENGHQRNEAIT
YTVKPETVQDPKEVTTQKPVEYKGGYSFISADGYEYQVLYKANKNGFQPY
VTAHKIKPDKS*

IP17319.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10915-PA 109 GF10915-PA 1..109 3..111 469 79.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14076-PA 109 GG14076-PA 1..109 3..111 540 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15644-PA 113 GH15644-PA 3..110 9..110 329 58.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Ay-PA 109 CG34271-PA 1..109 3..111 565 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12690-PA 112 GI12690-PA 28..109 33..110 283 68.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15511-PA 109 GL15511-PA 1..108 3..110 456 79.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23846-PA 109 GA23846-PA 1..108 3..110 454 78.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13859-PA 109 GM13859-PA 1..109 3..111 558 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13142-PA 109 GD13142-PA 1..109 3..111 505 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12675-PA 120 GJ12675-PA 21..108 24..107 322 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16911-PA 108 GK16911-PA 3..96 15..106 342 72.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20500-PA 109 GE20500-PA 1..109 3..111 533 90.8 Plus