IP17325.complete Sequence
465 bp assembled on 2006-11-28
GenBank Submission: BT029671
> IP17325.complete
AAACATCCAACATGAAGTTGTCCCTTGTTCTCTTCGTCCTCTCGATGGTT
TTGTATGTGGCCCATGTCAGAGCTGCTGACAGCAGCACAAGCACGGAATC
GAGTACCAGCACCACGGATAGCACCACCACGGAATCCACCACAGAGTCTA
CCACATCGTCGTCCTCTTCATCTAGTTCGGGCTCAAACAAGAAAATCGTG
CGTCTCAGCAATCTGAAGTACTCGATCACCAGGAAAATCAGAGTTGGATC
CACCACCAGTTCCTCGACCAGATCCAAAAGTTCCCGCGCCAAGTCCCGCA
AGGCCCGTCTAAATGCGGCTAAACGATCCAAGAAGGCCGCCAACCGAAAA
CTCAACAAGAAGTCCAAGAACCGCAATGTACGCGTGGTCCGCGGTTAGGT
TAGCCGCAATTATATTTTTAATAATAAATGGTTGAAATTTATACATAAAA
AAAAAAAAAAAAAAA
IP17325.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:22:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34273-RA | 449 | CG34273-RA | 1..449 | 1..449 | 2245 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:11:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 10341798..10342243 | 1..446 | 2230 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 14517042..14517490 | 1..449 | 2245 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 14257873..14258321 | 1..449 | 2245 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 23:11:18 has no hits.
IP17325.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:11:55 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 10341798..10342243 | 1..446 | 95 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:09 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..387 | 12..398 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:14 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..387 | 12..398 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:09 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..387 | 12..398 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:53 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..387 | 12..398 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:35 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..387 | 12..398 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:47 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..446 | 1..446 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:14 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..446 | 1..446 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:09 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..446 | 1..446 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:54 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..446 | 1..446 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:35 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34273-RA | 1..446 | 1..446 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:55 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14517042..14517487 | 1..446 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:55 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14517042..14517487 | 1..446 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:55 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14517042..14517487 | 1..446 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:09 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 10342764..10343209 | 1..446 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:47 Download gff for
IP17325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14257873..14258318 | 1..446 | 100 | | Plus |
IP17325.pep Sequence
Translation from 2 to 397
> IP17325.pep
TSNMKLSLVLFVLSMVLYVAHVRAADSSTSTESSTSTTDSTTTESTTEST
TSSSSSSSSGSNKKIVRLSNLKYSITRKIRVGSTTSSSTRSKSSRAKSRK
ARLNAAKRSKKAANRKLNKKSKNRNVRVVRG*
IP17325.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:28:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16857-PA | 136 | GG16857-PA | 1..136 | 4..131 | 309 | 72.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34273-PA | 128 | CG34273-PA | 1..128 | 4..131 | 597 | 100 | Plus |
CG14237-PB | 121 | CG14237-PB | 5..120 | 5..122 | 186 | 39.5 | Plus |
CG14851-PA | 152 | CG14851-PA | 49..152 | 25..131 | 174 | 36.4 | Plus |
CG42568-PB | 110 | CG42568-PB | 23..105 | 43..127 | 165 | 49.4 | Plus |
CG42568-PA | 110 | CG42568-PA | 23..105 | 43..127 | 165 | 49.4 | Plus |
CG8087-PA | 142 | CG8087-PA | 51..133 | 24..107 | 161 | 41.7 | Plus |
CG14265-PB | 119 | CG14265-PB | 1..114 | 4..127 | 154 | 37.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:28:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA30260-PA | 131 | GA30260-PA | 1..131 | 4..131 | 142 | 48.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:28:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18963-PA | 128 | GD18963-PA | 1..128 | 4..131 | 368 | 85.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:28:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24238-PA | 126 | GE24238-PA | 1..126 | 4..131 | 184 | 76.6 | Plus |
IP17325.hyp Sequence
Translation from 2 to 397
> IP17325.hyp
TSNMKLSLVLFVLSMVLYVAHVRAADSSTSTESSTSTTDSTTTESTTEST
TSSSSSSSSGSNKKIVRLSNLKYSITRKIRVGSTTSSSTRSKSSRAKSRK
ARLNAAKRSKKAANRKLNKKSKNRNVRVVRG*
IP17325.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:38:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34273-PA | 128 | CG34273-PA | 1..128 | 4..131 | 597 | 100 | Plus |
CG14237-PB | 121 | CG14237-PB | 5..120 | 5..122 | 186 | 39.5 | Plus |
CG14851-PA | 152 | CG14851-PA | 49..152 | 25..131 | 174 | 36.4 | Plus |
CG42568-PB | 110 | CG42568-PB | 23..105 | 43..127 | 165 | 49.4 | Plus |
CG42568-PA | 110 | CG42568-PA | 23..105 | 43..127 | 165 | 49.4 | Plus |