Clone IP17325 Report

Search the DGRC for IP17325

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:173
Well:25
Vector:pOT2
Associated Gene/TranscriptCG34273-RA
Protein status:IP17325.pep: gold
Sequenced Size:465

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34273 2008-04-29 Release 5.5 accounting
CG34273 2008-08-15 Release 5.9 accounting
CG34273 2008-12-18 5.12 accounting

Clone Sequence Records

IP17325.complete Sequence

465 bp assembled on 2006-11-28

GenBank Submission: BT029671

> IP17325.complete
AAACATCCAACATGAAGTTGTCCCTTGTTCTCTTCGTCCTCTCGATGGTT
TTGTATGTGGCCCATGTCAGAGCTGCTGACAGCAGCACAAGCACGGAATC
GAGTACCAGCACCACGGATAGCACCACCACGGAATCCACCACAGAGTCTA
CCACATCGTCGTCCTCTTCATCTAGTTCGGGCTCAAACAAGAAAATCGTG
CGTCTCAGCAATCTGAAGTACTCGATCACCAGGAAAATCAGAGTTGGATC
CACCACCAGTTCCTCGACCAGATCCAAAAGTTCCCGCGCCAAGTCCCGCA
AGGCCCGTCTAAATGCGGCTAAACGATCCAAGAAGGCCGCCAACCGAAAA
CTCAACAAGAAGTCCAAGAACCGCAATGTACGCGTGGTCCGCGGTTAGGT
TAGCCGCAATTATATTTTTAATAATAAATGGTTGAAATTTATACATAAAA
AAAAAAAAAAAAAAA

IP17325.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34273-RA 449 CG34273-RA 1..449 1..449 2245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10341798..10342243 1..446 2230 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14517042..14517490 1..449 2245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14257873..14258321 1..449 2245 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:11:18 has no hits.

IP17325.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:11:55 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10341798..10342243 1..446 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:09 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..387 12..398 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:14 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..387 12..398 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:09 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..387 12..398 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:53 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..387 12..398 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:35 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..387 12..398 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:47 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..446 1..446 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:14 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..446 1..446 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:09 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..446 1..446 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:54 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..446 1..446 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:35 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
CG34273-RA 1..446 1..446 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:55 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14517042..14517487 1..446 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:55 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14517042..14517487 1..446 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:11:55 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14517042..14517487 1..446 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:09 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10342764..10343209 1..446 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:47 Download gff for IP17325.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14257873..14258318 1..446 100   Plus

IP17325.pep Sequence

Translation from 2 to 397

> IP17325.pep
TSNMKLSLVLFVLSMVLYVAHVRAADSSTSTESSTSTTDSTTTESTTEST
TSSSSSSSSGSNKKIVRLSNLKYSITRKIRVGSTTSSSTRSKSSRAKSRK
ARLNAAKRSKKAANRKLNKKSKNRNVRVVRG*

IP17325.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16857-PA 136 GG16857-PA 1..136 4..131 309 72.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34273-PA 128 CG34273-PA 1..128 4..131 597 100 Plus
CG14237-PB 121 CG14237-PB 5..120 5..122 186 39.5 Plus
CG14851-PA 152 CG14851-PA 49..152 25..131 174 36.4 Plus
CG42568-PB 110 CG42568-PB 23..105 43..127 165 49.4 Plus
CG42568-PA 110 CG42568-PA 23..105 43..127 165 49.4 Plus
CG8087-PA 142 CG8087-PA 51..133 24..107 161 41.7 Plus
CG14265-PB 119 CG14265-PB 1..114 4..127 154 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30260-PA 131 GA30260-PA 1..131 4..131 142 48.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18963-PA 128 GD18963-PA 1..128 4..131 368 85.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24238-PA 126 GE24238-PA 1..126 4..131 184 76.6 Plus

IP17325.hyp Sequence

Translation from 2 to 397

> IP17325.hyp
TSNMKLSLVLFVLSMVLYVAHVRAADSSTSTESSTSTTDSTTTESTTEST
TSSSSSSSSGSNKKIVRLSNLKYSITRKIRVGSTTSSSTRSKSSRAKSRK
ARLNAAKRSKKAANRKLNKKSKNRNVRVVRG*

IP17325.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34273-PA 128 CG34273-PA 1..128 4..131 597 100 Plus
CG14237-PB 121 CG14237-PB 5..120 5..122 186 39.5 Plus
CG14851-PA 152 CG14851-PA 49..152 25..131 174 36.4 Plus
CG42568-PB 110 CG42568-PB 23..105 43..127 165 49.4 Plus
CG42568-PA 110 CG42568-PA 23..105 43..127 165 49.4 Plus