Clone IP17352 Report

Search the DGRC for IP17352

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:173
Well:52
Vector:pOT2
Associated Gene/TranscriptCG34292-RA
Protein status:IP17352.pep: gold
Sequenced Size:865

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34292 2008-04-29 Release 5.5 accounting
CG34292 2008-08-15 Release 5.9 accounting
CG34292 2008-12-18 5.12 accounting

Clone Sequence Records

IP17352.complete Sequence

865 bp assembled on 2006-11-28

GenBank Submission: BT029680

> IP17352.complete
ATCGGTAGAACATAATAGTAAAATACAAAATTCCAAAATAATAAAAAAAA
TAACCTATTAATAATGTTTCGTTCTCTATCCGTGCTGATGTTCAATACTT
CTCAAATAGAGACAAATCTCTTTGGCATGGCCGACGATGTGTACAATACC
ATTGAGATCTTCAAAGAGGCCGCCAGTTTCGAGGCCAAGATTGGTAGACC
CTATAGAATGATATCGAGCCTTATAGACTGCTTGGTCTTCATGGTGGTGG
CTCTAATGGTGGTCGGTTTCATCATGTACGATCGCATTATGCTGTTTACA
AAACTGGCTAAGATCAATCAGAGATATAACCAAGAGGTGACTGTAAAAGC
AAAAAGAATTCGAAAGCCCAAAACATCCGATTCTCTCCCAGAAGAAGATG
ATACCGAAAATGCTGTGGATCAGGCAGAAGAAGACGGTATCAGCGTGGCA
CATTCCGAATATGCAACAGATGACGATGTCGCAACCCTTCAACCCATTGA
CGATGAAGATACAATTAAAGTCGCAATGTTCGGAACTCCCAATTGGGCCT
TTAAATGGCTAGCCACTATAAGAAACGAAAGTTTCGGATCAATTTACGAT
GGGTACTTCCGTAGATTGCATCTACACGTCACACATTGTAAATCGGTTTA
GTCATTTTCTGAGTTCCACGACATACGGATTTGCGGTTGACGATTTAAAT
TGGTTATTAGGCAGATTCCAGTACCATAAATTACCTTATTATACTCGATA
TGTATATGAACATCCACATACGTTTAAATAATGAACATGACTCATTTAGT
AACGAATGCATTTAGCAATAAAGGAAAATTTACAAATTTTTACAAGTAAA
AAAAAAAAAAAAAAA

IP17352.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34292-RA 849 CG34292-RA 4..849 4..849 4230 100 Plus
CG34292.a 794 CG34292.a 335..794 390..849 2300 100 Plus
CG34292.a 794 CG34292.a 4..336 4..336 1665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22885257..22886100 4..847 4130 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27062216..27063061 4..849 4230 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26803047..26803892 4..849 4230 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:01:25 has no hits.

IP17352.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:02:15 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22885254..22886100 1..847 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:19 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..588 64..651 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:17:00 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..588 64..651 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:15 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..588 64..651 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:27:53 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..588 64..651 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:03 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..588 64..651 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:45:31 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..844 4..847 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:17:00 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..844 4..847 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:15 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..844 4..847 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:27:54 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..844 4..847 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:03 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34292-RA 1..844 4..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:15 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27062213..27063059 1..847 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:15 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27062213..27063059 1..847 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:02:15 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27062213..27063059 1..847 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:15 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22887935..22888781 1..847 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:47:09 Download gff for IP17352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26803044..26803890 1..847 99   Plus

IP17352.hyp Sequence

Translation from 63 to 650

> IP17352.hyp
MFRSLSVLMFNTSQIETNLFGMADDVYNTIEIFKEAASFEAKIGRPYRMI
SSLIDCLVFMVVALMVVGFIMYDRIMLFTKLAKINQRYNQEVTVKAKRIR
KPKTSDSLPEEDDTENAVDQAEEDGISVAHSEYATDDDVATLQPIDDEDT
IKVAMFGTPNWAFKWLATIRNESFGSIYDGYFRRLHLHVTHCKSV*

IP17352.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34292-PA 195 CG34292-PA 1..195 1..195 1003 100 Plus

IP17352.pep Sequence

Translation from 63 to 650

> IP17352.pep
MFRSLSVLMFNTSQIETNLFGMADDVYNTIEIFKEAASFEAKIGRPYRMI
SSLIDCLVFMVVALMVVGFIMYDRIMLFTKLAKINQRYNQEVTVKAKRIR
KPKTSDSLPEEDDTENAVDQAEEDGISVAHSEYATDDDVATLQPIDDEDT
IKVAMFGTPNWAFKWLATIRNESFGSIYDGYFRRLHLHVTHCKSV*

IP17352.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23270-PA 186 GF23270-PA 1..186 1..183 360 45.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34292-PA 195 CG34292-PA 1..195 1..195 1003 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12958-PA 165 GL12958-PA 1..152 8..168 169 31.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22979-PA 165 GA22979-PA 1..152 8..168 154 30.5 Plus