IP17360.complete Sequence
522 bp assembled on 2006-11-28
GenBank Submission: BT029682
> IP17360.complete
ATGCAGAATCCCATTTGTGAACCGTTCACCAGTTGGCCGGTAAAGTTCGA
CATCAACCAGCTCATCAAGGAGTTCCAGCCCGAGGAGAAGGGGCGCCAGG
TAGATGAGGATAAGTCGCCGCGGGACTTTCTCCACCTACCCGACAACAAC
TGGGTGGTCCTGCCCAGTTTTAAGTACCAATTCGAGCACTTGACCCCGTA
TCTTTCCTGCCGCCAGAGCAAATATATGCGGTGCCGCTTTCAGAAGTTTT
TAGATAATGTTCCCAGCAGCTATGTGACCATCTCCTTGTATGGCTCCAAT
GTGAGCAACATGCCTAAGCCGAGGCGAAAGAGTCTGAATGGCCAGTTCTA
CGGGGTGGATAACAAACTGGCTCCTGTTCCGGCGGTCGCAGATCCTCGCT
CTCCTCCGCACCGAAAGTAGTGATATAAATTAACAAGCAATTTAAAATTT
TTGGTGGAATTACTGCTTAGATAAATATAATATTCTTTTTGTTCTATGCC
TAAAAAAAAAAAAAAAAAAAAA
IP17360.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:03:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34298-RA | 584 | CG34298-RA | 84..584 | 1..501 | 2490 | 99.8 | Plus |
CG34298.a | 541 | CG34298.a | 49..348 | 1..300 | 1500 | 100 | Plus |
CG34298.a | 541 | CG34298.a | 349..541 | 309..501 | 950 | 99.4 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:56:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 25822221..25822528 | 1..308 | 1510 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 25822590..25822782 | 309..501 | 890 | 97.4 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29999842..30000149 | 1..308 | 1540 | 100 | Plus |
3R | 32079331 | 3R | 30000211..30000404 | 309..502 | 955 | 99.5 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 29740673..29740980 | 1..308 | 1540 | 100 | Plus |
3R | 31820162 | 3R | 29741042..29741235 | 309..502 | 955 | 99.4 | Plus |
Blast to na_te.dros performed on 2019-03-16 19:56:18 has no hits.
IP17360.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:56:59 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 25822221..25822528 | 1..308 | 99 | -> | Plus |
chr3R | 25822590..25822782 | 309..501 | 97 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:21 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 1..420 | 1..420 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:58 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 1..420 | 1..420 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:19 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 1..420 | 1..420 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:17 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 1..420 | 1..420 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:46:42 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 1..420 | 1..420 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:16 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 1..501 | 1..501 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:58 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 48..548 | 1..501 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:19 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 48..548 | 1..501 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:17 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 1..501 | 1..501 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:46:42 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34298-RA | 48..548 | 1..501 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:59 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30000211..30000403 | 309..501 | 99 | | Plus |
3R | 29999842..30000149 | 1..308 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:59 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30000211..30000403 | 309..501 | 99 | | Plus |
3R | 29999842..30000149 | 1..308 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:59 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 30000211..30000403 | 309..501 | 99 | | Plus |
3R | 29999842..30000149 | 1..308 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:19 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25825564..25825871 | 1..308 | 100 | -> | Plus |
arm_3R | 25825933..25826125 | 309..501 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:26 Download gff for
IP17360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29740673..29740980 | 1..308 | 100 | -> | Plus |
3R | 29741042..29741234 | 309..501 | 99 | | Plus |
IP17360.pep Sequence
Translation from 0 to 419
> IP17360.pep
MQNPICEPFTSWPVKFDINQLIKEFQPEEKGRQVDEDKSPRDFLHLPDNN
WVVLPSFKYQFEHLTPYLSCRQSKYMRCRFQKFLDNVPSSYVTISLYGSN
VSNMPKPRRKSLNGQFYGVDNKLAPVPAVADPRSPPHRK*
IP17360.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:13:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF18814-PA | 133 | GF18814-PA | 1..133 | 1..133 | 511 | 68.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:13:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG11717-PA | 139 | GG11717-PA | 1..139 | 1..139 | 721 | 97.8 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:13:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH18552-PA | 111 | GH18552-PA | 5..100 | 4..99 | 305 | 56.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34298-PA | 139 | CG34298-PA | 1..139 | 1..139 | 763 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:13:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL14015-PA | 143 | GL14015-PA | 1..133 | 1..133 | 512 | 68.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:13:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA26933-PA | 143 | GA26933-PA | 1..133 | 1..133 | 512 | 68.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:13:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12849-PA | 139 | GM12849-PA | 1..139 | 1..139 | 725 | 97.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:13:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21491-PA | 139 | GD21491-PA | 1..139 | 1..139 | 731 | 98.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:13:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE10846-PA | 139 | GE10846-PA | 1..139 | 1..139 | 689 | 92.8 | Plus |
IP17360.hyp Sequence
Translation from 1 to 419
> IP17360.hyp
MQNPICEPFTSWPVKFDINQLIKEFQPEEKGRQVDEDKSPRDFLHLPDNN
WVVLPSFKYQFEHLTPYLSCRQSKYMRCRFQKFLDNVPSSYVTISLYGSN
VSNMPKPRRKSLNGQFYGVDNKLAPVPAVADPRSPPHRK*
IP17360.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34298-PA | 139 | CG34298-PA | 1..139 | 1..139 | 763 | 100 | Plus |