Clone IP17360 Report

Search the DGRC for IP17360

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:173
Well:60
Vector:pOT2
Associated Gene/TranscriptCG34298-RA
Protein status:IP17360.pep: gold
Sequenced Size:522

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34298 2008-04-29 Release 5.5 accounting
CG34298 2008-08-15 Release 5.9 accounting
CG34298 2008-12-18 5.12 accounting

Clone Sequence Records

IP17360.complete Sequence

522 bp assembled on 2006-11-28

GenBank Submission: BT029682

> IP17360.complete
ATGCAGAATCCCATTTGTGAACCGTTCACCAGTTGGCCGGTAAAGTTCGA
CATCAACCAGCTCATCAAGGAGTTCCAGCCCGAGGAGAAGGGGCGCCAGG
TAGATGAGGATAAGTCGCCGCGGGACTTTCTCCACCTACCCGACAACAAC
TGGGTGGTCCTGCCCAGTTTTAAGTACCAATTCGAGCACTTGACCCCGTA
TCTTTCCTGCCGCCAGAGCAAATATATGCGGTGCCGCTTTCAGAAGTTTT
TAGATAATGTTCCCAGCAGCTATGTGACCATCTCCTTGTATGGCTCCAAT
GTGAGCAACATGCCTAAGCCGAGGCGAAAGAGTCTGAATGGCCAGTTCTA
CGGGGTGGATAACAAACTGGCTCCTGTTCCGGCGGTCGCAGATCCTCGCT
CTCCTCCGCACCGAAAGTAGTGATATAAATTAACAAGCAATTTAAAATTT
TTGGTGGAATTACTGCTTAGATAAATATAATATTCTTTTTGTTCTATGCC
TAAAAAAAAAAAAAAAAAAAAA

IP17360.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34298-RA 584 CG34298-RA 84..584 1..501 2490 99.8 Plus
CG34298.a 541 CG34298.a 49..348 1..300 1500 100 Plus
CG34298.a 541 CG34298.a 349..541 309..501 950 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25822221..25822528 1..308 1510 99.4 Plus
chr3R 27901430 chr3R 25822590..25822782 309..501 890 97.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29999842..30000149 1..308 1540 100 Plus
3R 32079331 3R 30000211..30000404 309..502 955 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29740673..29740980 1..308 1540 100 Plus
3R 31820162 3R 29741042..29741235 309..502 955 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 19:56:18 has no hits.

IP17360.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:56:59 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25822221..25822528 1..308 99 -> Plus
chr3R 25822590..25822782 309..501 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:21 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 1..420 1..420 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:58 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 1..420 1..420 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:19 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 1..420 1..420 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:03:17 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 1..420 1..420 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:46:42 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 1..420 1..420 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:28:16 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 1..501 1..501 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:58 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 48..548 1..501 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:19 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 48..548 1..501 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:03:17 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 1..501 1..501 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:46:42 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34298-RA 48..548 1..501 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:59 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30000211..30000403 309..501 99   Plus
3R 29999842..30000149 1..308 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:59 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30000211..30000403 309..501 99   Plus
3R 29999842..30000149 1..308 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:56:59 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30000211..30000403 309..501 99   Plus
3R 29999842..30000149 1..308 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:19 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25825564..25825871 1..308 100 -> Plus
arm_3R 25825933..25826125 309..501 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:26 Download gff for IP17360.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29740673..29740980 1..308 100 -> Plus
3R 29741042..29741234 309..501 99   Plus

IP17360.pep Sequence

Translation from 0 to 419

> IP17360.pep
MQNPICEPFTSWPVKFDINQLIKEFQPEEKGRQVDEDKSPRDFLHLPDNN
WVVLPSFKYQFEHLTPYLSCRQSKYMRCRFQKFLDNVPSSYVTISLYGSN
VSNMPKPRRKSLNGQFYGVDNKLAPVPAVADPRSPPHRK*

IP17360.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18814-PA 133 GF18814-PA 1..133 1..133 511 68.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11717-PA 139 GG11717-PA 1..139 1..139 721 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18552-PA 111 GH18552-PA 5..100 4..99 305 56.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34298-PA 139 CG34298-PA 1..139 1..139 763 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14015-PA 143 GL14015-PA 1..133 1..133 512 68.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26933-PA 143 GA26933-PA 1..133 1..133 512 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12849-PA 139 GM12849-PA 1..139 1..139 725 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21491-PA 139 GD21491-PA 1..139 1..139 731 98.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10846-PA 139 GE10846-PA 1..139 1..139 689 92.8 Plus

IP17360.hyp Sequence

Translation from 1 to 419

> IP17360.hyp
MQNPICEPFTSWPVKFDINQLIKEFQPEEKGRQVDEDKSPRDFLHLPDNN
WVVLPSFKYQFEHLTPYLSCRQSKYMRCRFQKFLDNVPSSYVTISLYGSN
VSNMPKPRRKSLNGQFYGVDNKLAPVPAVADPRSPPHRK*

IP17360.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34298-PA 139 CG34298-PA 1..139 1..139 763 100 Plus