Clone IP17374 Report

Search the DGRC for IP17374

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:173
Well:74
Vector:pOT2
Associated Gene/TranscriptCG34307-RB
Protein status:IP17374.pep: gold
Sequenced Size:747

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34307 2008-04-29 Release 5.5 accounting
CG34307 2008-08-15 Release 5.9 accounting
CG34307 2008-12-18 5.12 accounting

Clone Sequence Records

IP17374.complete Sequence

747 bp assembled on 2006-11-29

GenBank Submission: BT029684

> IP17374.complete
AGAACATAATCAAAATTATTAGCTAAAATTTCACGTGAACTTTCTCTCTA
AGCCATCAAACCCCAAATTGGAAGAATGATCAATGAGCTATCCGCTCCTA
AGCTTAAGCTTGTATTCATTAATGTATTTTCGATTTTGCACAGTACCACT
TATTTGAATGTGTACCGCTTATATGCAGACTTAAAAAATGTTAAAGCTGG
CGTGGATGGGTCTAATGAGGAGCTTTGGATCAGGGAAATCTTTACATTCC
TCATCAGTGCTCTCATAGTGATTCGCTTTTGTCTATGCTTCGTAGGATTG
GCTTCTAACATTGTGGCCATATACCCAATTCTAACAAATTCGCAAGCTGA
GATGCTTATGCCTACCATTATAGTGCAGGCCATTGACAAAGTCATTCTAA
ATCTATACGAGATTATTTTGGGCTACGGCAGCTTGTGCTATCTCTATCCT
GAAAGTACGGCTGTTTTCATCTTCTTCCTTATACAGATGGGAGCCAAGAT
TGTCTGCAGCATCTCTGTCTTGAATATTTATTCGGACCATCACAATCACT
TGGCAACTCTAGTTTCCTTCAACGAGGAATCACATAGCTTGGGACCAGAC
AGTGTAGAAGAAATCGAATTGGGGAACCAAAACTTGGATTTTTCCTAACT
AATTATATATATATATATATTTCAAAATAGAATGAATAATATACTATCAA
ATCTGCAGATATTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP17374.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34307-RB 720 CG34307-RB 2..720 1..715 3510 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7723068..7723387 1..320 1600 100 Plus
chr3R 27901430 chr3R 7723447..7723648 321..522 1010 100 Plus
chr3R 27901430 chr3R 7723709..7723903 522..714 910 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11897582..11897901 1..320 1600 100 Plus
3R 32079331 3R 11897961..11898162 321..522 1010 100 Plus
3R 32079331 3R 11898223..11898421 522..716 900 98 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11638413..11638732 1..320 1600 100 Plus
3R 31820162 3R 11638792..11638993 321..522 1010 100 Plus
3R 31820162 3R 11639054..11639252 522..716 910 97.9 Plus
Blast to na_te.dros performed on 2019-03-16 21:02:46 has no hits.

IP17374.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:03:44 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7723068..7723387 1..320 100 -> Plus
chr3R 7723447..7723647 321..521 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:25 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RA 1..450 76..524 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:16:06 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RB 1..573 76..648 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:45:05 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RB 1..573 76..648 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:26:39 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RA 1..450 76..524 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:03:24 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RB 1..573 76..648 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:44:40 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RA 1..521 1..521 100 -> Plus
CG34307-RA 583..779 522..714 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:16:05 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RB 1..718 1..714 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:05 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RB 1..718 1..714 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:26:40 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RA 1..521 1..521 100 -> Plus
CG34307-RA 583..779 522..714 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:03:24 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
CG34307-RB 1..718 1..714 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:44 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11897582..11897901 1..320 100 -> Plus
3R 11897961..11898161 321..521 100 -> Plus
3R 11898223..11898419 522..714 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:44 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11897582..11897901 1..320 100 -> Plus
3R 11897961..11898161 321..521 100 -> Plus
3R 11898223..11898419 522..714 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:03:44 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11897582..11897901 1..320 100 -> Plus
3R 11897961..11898161 321..521 100 -> Plus
3R 11898223..11898419 522..714 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:05 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7723304..7723623 1..320 100 -> Plus
arm_3R 7723683..7723883 321..521 100 -> Plus
arm_3R 7723945..7724141 522..714 97   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:46:30 Download gff for IP17374.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11638413..11638732 1..320 100 -> Plus
3R 11638792..11638992 321..521 100 -> Plus
3R 11639054..11639250 522..714 97   Plus

IP17374.hyp Sequence

Translation from 75 to 647

> IP17374.hyp
MINELSAPKLKLVFINVFSILHSTTYLNVYRLYADLKNVKAGVDGSNEEL
WIREIFTFLISALIVIRFCLCFVGLASNIVAIYPILTNSQAEMLMPTIIV
QAIDKVILNLYEIILGYGSLCYLYPESTAVFIFFLIQMGAKIVCSISVLN
IYSDHHNHLATLVSFNEESHSLGPDSVEEIELGNQNLDFS*

IP17374.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG34307-PB 190 CG34307-PB 1..190 1..190 961 100 Plus

IP17374.pep Sequence

Translation from 75 to 647

> IP17374.pep
MINELSAPKLKLVFINVFSILHSTTYLNVYRLYADLKNVKAGVDGSNEEL
WIREIFTFLISALIVIRFCLCFVGLASNIVAIYPILTNSQAEMLMPTIIV
QAIDKVILNLYEIILGYGSLCYLYPESTAVFIFFLIQMGAKIVCSISVLN
IYSDHHNHLATLVSFNEESHSLGPDSVEEIELGNQNLDFS*

IP17374.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23170-PA 188 GF23170-PA 1..186 2..187 698 69.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34307-PB 190 CG34307-PB 1..190 1..190 961 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30218-PA 189 GA30218-PA 1..186 1..187 441 47.9 Plus