BDGP Sequence Production Resources |
Search the DGRC for IP17405
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 174 |
Well: | 5 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34251-RA |
Protein status: | IP17405.pep: gold |
Sequenced Size: | 661 |
Gene | Date | Evidence |
---|---|---|
CG34251 | 2008-04-29 | Release 5.5 accounting |
CG34251 | 2008-08-15 | Release 5.9 accounting |
CG34251 | 2008-12-18 | 5.12 accounting |
661 bp assembled on 2006-11-28
GenBank Submission: BT029689
> IP17405.complete ATTTTTCGGCAGCGGTAACCATTAAAATCAACGACCAATTGGCCCAGCAT TAAACGCCCAGGATGGCTGGAATCAGTGGAAGTTCCCAGCCGCGTCTGCA GCTATATATATTCTTGTGCCTGATGGCGTCGGTGTTTGCTTCATTACCGG AGGAACTGAGAGGAGCTGCAGGACCTGAATCGAGAATGGATGTTCTAGGA CTCTCGCCGGGACAAAGAGTCCTGGCTGCAGTGCCTGCGTCAGGACGCAC GAGTTTTTTGCTGTACCAATTAGCTTTGGCCATAAATTCAGCCGCCGGCC TGGAATCGCCAACGATGCAGGAAGTGGAGGTGGTCGATGTGGTGGAGAAC CAGGAGCAGTTCCTGCCGGCGAGCCCGGATCCCAACTGGCTGGCCGCCAT GGCGAATGAGTTTCAGAGTGTGCCAGTGTACGAGACCTTTCCGGCGGACT TGCAGAACTGGCTGATGGATGGCTACGGGATCAGTGCCACGGATTTCTAC CACAGCTGGAGCAGAGCAGGATTTGGCAGGAGGAGCAGCTCCCGCACCCA GCTGATCTGTACGGCAGATGGCCAGTGCTATGAGGTCAACAAAATCGTCA CTGCCTGCTGTCCATTTTGAGCATCCAATAAAGGCATTGAAAACAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 17672549..17672782 | 411..644 | 1155 | 99.6 | Plus |
chr3L | 24539361 | chr3L | 17663257..17663445 | 56..244 | 945 | 100 | Plus |
chr3L | 24539361 | chr3L | 17667010..17667185 | 241..416 | 880 | 100 | Plus |
chr3L | 24539361 | chr3L | 17661225..17661280 | 1..56 | 280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 17682933..17683168 | 411..646 | 1180 | 100 | Plus |
3L | 28110227 | 3L | 17673650..17673838 | 56..244 | 945 | 100 | Plus |
3L | 28110227 | 3L | 17677399..17677574 | 241..416 | 880 | 100 | Plus |
3L | 28110227 | 3L | 17671622..17671677 | 1..56 | 280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 17676033..17676268 | 411..646 | 1180 | 100 | Plus |
3L | 28103327 | 3L | 17666750..17666938 | 56..244 | 945 | 100 | Plus |
3L | 28103327 | 3L | 17670499..17670674 | 241..416 | 880 | 100 | Plus |
3L | 28103327 | 3L | 17664722..17664777 | 1..56 | 280 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 17667013..17667185 | 244..416 | 100 | -> | Plus |
chr3L | 17661225..17661280 | 1..56 | 100 | -> | Plus |
chr3L | 17663258..17663444 | 57..243 | 100 | -> | Plus |
chr3L | 17672555..17672782 | 417..644 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..558 | 63..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RB | 1..558 | 63..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..558 | 63..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..558 | 63..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..558 | 63..620 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..639 | 1..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..644 | 1..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..644 | 1..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..639 | 1..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34251-RA | 1..644 | 1..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17671622..17671677 | 1..56 | 100 | -> | Plus |
3L | 17673651..17673837 | 57..243 | 100 | -> | Plus |
3L | 17677402..17677574 | 244..416 | 100 | -> | Plus |
3L | 17682939..17683166 | 417..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17671622..17671677 | 1..56 | 100 | -> | Plus |
3L | 17673651..17673837 | 57..243 | 100 | -> | Plus |
3L | 17677402..17677574 | 244..416 | 100 | -> | Plus |
3L | 17682939..17683166 | 417..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17671622..17671677 | 1..56 | 100 | -> | Plus |
3L | 17673651..17673837 | 57..243 | 100 | -> | Plus |
3L | 17677402..17677574 | 244..416 | 100 | -> | Plus |
3L | 17682939..17683166 | 417..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 17664722..17664777 | 1..56 | 100 | -> | Plus |
arm_3L | 17666751..17666937 | 57..243 | 100 | -> | Plus |
arm_3L | 17670502..17670674 | 244..416 | 100 | -> | Plus |
arm_3L | 17676039..17676266 | 417..644 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 17664722..17664777 | 1..56 | 100 | -> | Plus |
3L | 17666751..17666937 | 57..243 | 100 | -> | Plus |
3L | 17670502..17670674 | 244..416 | 100 | -> | Plus |
3L | 17676039..17676266 | 417..644 | 100 | Plus |
Translation from 62 to 619
> IP17405.pep MAGISGSSQPRLQLYIFLCLMASVFASLPEELRGAAGPESRMDVLGLSPG QRVLAAVPASGRTSFLLYQLALAINSAAGLESPTMQEVEVVDVVENQEQF LPASPDPNWLAAMANEFQSVPVYETFPADLQNWLMDGYGISATDFYHSWS RAGFGRRSSSRTQLICTADGQCYEVNKIVTACCPF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10545-PA | 194 | GF10545-PA | 15..194 | 1..185 | 493 | 58.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13629-PA | 189 | GG13629-PA | 1..189 | 1..185 | 778 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34251-PB | 185 | CG34251-PB | 1..185 | 1..185 | 959 | 100 | Plus |
CG34251-PA | 185 | CG34251-PA | 1..185 | 1..185 | 959 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12391-PA | 168 | GI12391-PA | 31..168 | 43..185 | 285 | 46.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24912-PA | 165 | GL24912-PA | 12..165 | 44..185 | 449 | 64.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23549-PA | 165 | GA23549-PA | 12..165 | 44..185 | 453 | 64.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25715-PA | 185 | GM25715-PA | 1..185 | 1..185 | 887 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14723-PA | 101 | GD14723-PA | 1..101 | 85..185 | 544 | 98 | Plus |
Dsim\GD14721-PA | 146 | GD14721-PA | 1..60 | 1..60 | 280 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12282-PA | 167 | GJ12282-PA | 42..167 | 49..185 | 307 | 52.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12299-PA | 192 | GK12299-PA | 44..192 | 43..185 | 349 | 46.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19925-PA | 101 | GE19925-PA | 1..101 | 85..185 | 533 | 96 | Plus |
Translation from 62 to 619
> IP17405.hyp MAGISGSSQPRLQLYIFLCLMASVFASLPEELRGAAGPESRMDVLGLSPG QRVLAAVPASGRTSFLLYQLALAINSAAGLESPTMQEVEVVDVVENQEQF LPASPDPNWLAAMANEFQSVPVYETFPADLQNWLMDGYGISATDFYHSWS RAGFGRRSSSRTQLICTADGQCYEVNKIVTACCPF*