Clone IP17405 Report

Search the DGRC for IP17405

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:174
Well:5
Vector:pOT2
Associated Gene/TranscriptCG34251-RA
Protein status:IP17405.pep: gold
Sequenced Size:661

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34251 2008-04-29 Release 5.5 accounting
CG34251 2008-08-15 Release 5.9 accounting
CG34251 2008-12-18 5.12 accounting

Clone Sequence Records

IP17405.complete Sequence

661 bp assembled on 2006-11-28

GenBank Submission: BT029689

> IP17405.complete
ATTTTTCGGCAGCGGTAACCATTAAAATCAACGACCAATTGGCCCAGCAT
TAAACGCCCAGGATGGCTGGAATCAGTGGAAGTTCCCAGCCGCGTCTGCA
GCTATATATATTCTTGTGCCTGATGGCGTCGGTGTTTGCTTCATTACCGG
AGGAACTGAGAGGAGCTGCAGGACCTGAATCGAGAATGGATGTTCTAGGA
CTCTCGCCGGGACAAAGAGTCCTGGCTGCAGTGCCTGCGTCAGGACGCAC
GAGTTTTTTGCTGTACCAATTAGCTTTGGCCATAAATTCAGCCGCCGGCC
TGGAATCGCCAACGATGCAGGAAGTGGAGGTGGTCGATGTGGTGGAGAAC
CAGGAGCAGTTCCTGCCGGCGAGCCCGGATCCCAACTGGCTGGCCGCCAT
GGCGAATGAGTTTCAGAGTGTGCCAGTGTACGAGACCTTTCCGGCGGACT
TGCAGAACTGGCTGATGGATGGCTACGGGATCAGTGCCACGGATTTCTAC
CACAGCTGGAGCAGAGCAGGATTTGGCAGGAGGAGCAGCTCCCGCACCCA
GCTGATCTGTACGGCAGATGGCCAGTGCTATGAGGTCAACAAAATCGTCA
CTGCCTGCTGTCCATTTTGAGCATCCAATAAAGGCATTGAAAACAAAAAA
AAAAAAAAAAA

IP17405.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34251-RA 1114 CG34251-RA 43..688 1..646 3230 100 Plus
CG34251-RB 1222 CG34251-RB 219..809 56..646 2955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17672549..17672782 411..644 1155 99.6 Plus
chr3L 24539361 chr3L 17663257..17663445 56..244 945 100 Plus
chr3L 24539361 chr3L 17667010..17667185 241..416 880 100 Plus
chr3L 24539361 chr3L 17661225..17661280 1..56 280 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17682933..17683168 411..646 1180 100 Plus
3L 28110227 3L 17673650..17673838 56..244 945 100 Plus
3L 28110227 3L 17677399..17677574 241..416 880 100 Plus
3L 28110227 3L 17671622..17671677 1..56 280 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17676033..17676268 411..646 1180 100 Plus
3L 28103327 3L 17666750..17666938 56..244 945 100 Plus
3L 28103327 3L 17670499..17670674 241..416 880 100 Plus
3L 28103327 3L 17664722..17664777 1..56 280 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:57:15 has no hits.

IP17405.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:58:17 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17667013..17667185 244..416 100 -> Plus
chr3L 17661225..17661280 1..56 100 -> Plus
chr3L 17663258..17663444 57..243 100 -> Plus
chr3L 17672555..17672782 417..644 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:09:40 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..558 63..620 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:17:06 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RB 1..558 63..620 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:29 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..558 63..620 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:28:02 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..558 63..620 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:47:07 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..558 63..620 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:09:40 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..639 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:17:06 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..644 1..644 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:29 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..644 1..644 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:28:02 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..639 1..639 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:47:07 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
CG34251-RA 1..644 1..644 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:17 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17671622..17671677 1..56 100 -> Plus
3L 17673651..17673837 57..243 100 -> Plus
3L 17677402..17677574 244..416 100 -> Plus
3L 17682939..17683166 417..644 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:17 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17671622..17671677 1..56 100 -> Plus
3L 17673651..17673837 57..243 100 -> Plus
3L 17677402..17677574 244..416 100 -> Plus
3L 17682939..17683166 417..644 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:17 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17671622..17671677 1..56 100 -> Plus
3L 17673651..17673837 57..243 100 -> Plus
3L 17677402..17677574 244..416 100 -> Plus
3L 17682939..17683166 417..644 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:29 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17664722..17664777 1..56 100 -> Plus
arm_3L 17666751..17666937 57..243 100 -> Plus
arm_3L 17670502..17670674 244..416 100 -> Plus
arm_3L 17676039..17676266 417..644 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:47:13 Download gff for IP17405.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17664722..17664777 1..56 100 -> Plus
3L 17666751..17666937 57..243 100 -> Plus
3L 17670502..17670674 244..416 100 -> Plus
3L 17676039..17676266 417..644 100   Plus

IP17405.pep Sequence

Translation from 62 to 619

> IP17405.pep
MAGISGSSQPRLQLYIFLCLMASVFASLPEELRGAAGPESRMDVLGLSPG
QRVLAAVPASGRTSFLLYQLALAINSAAGLESPTMQEVEVVDVVENQEQF
LPASPDPNWLAAMANEFQSVPVYETFPADLQNWLMDGYGISATDFYHSWS
RAGFGRRSSSRTQLICTADGQCYEVNKIVTACCPF*

IP17405.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10545-PA 194 GF10545-PA 15..194 1..185 493 58.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13629-PA 189 GG13629-PA 1..189 1..185 778 90.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34251-PB 185 CG34251-PB 1..185 1..185 959 100 Plus
CG34251-PA 185 CG34251-PA 1..185 1..185 959 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12391-PA 168 GI12391-PA 31..168 43..185 285 46.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24912-PA 165 GL24912-PA 12..165 44..185 449 64.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23549-PA 165 GA23549-PA 12..165 44..185 453 64.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25715-PA 185 GM25715-PA 1..185 1..185 887 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14723-PA 101 GD14723-PA 1..101 85..185 544 98 Plus
Dsim\GD14721-PA 146 GD14721-PA 1..60 1..60 280 93.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12282-PA 167 GJ12282-PA 42..167 49..185 307 52.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12299-PA 192 GK12299-PA 44..192 43..185 349 46.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19925-PA 101 GE19925-PA 1..101 85..185 533 96 Plus

IP17405.hyp Sequence

Translation from 62 to 619

> IP17405.hyp
MAGISGSSQPRLQLYIFLCLMASVFASLPEELRGAAGPESRMDVLGLSPG
QRVLAAVPASGRTSFLLYQLALAINSAAGLESPTMQEVEVVDVVENQEQF
LPASPDPNWLAAMANEFQSVPVYETFPADLQNWLMDGYGISATDFYHSWS
RAGFGRRSSSRTQLICTADGQCYEVNKIVTACCPF*

IP17405.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34251-PB 185 CG34251-PB 1..185 1..185 959 100 Plus
CG34251-PA 185 CG34251-PA 1..185 1..185 959 100 Plus