IP17431.complete Sequence
380 bp assembled on 2006-11-28
GenBank Submission: BT029695
> IP17431.complete
CCAACATGAAGTTGATCATCCTGATCGCTTTTTTGGCTCTTCTTAATCTA
GCGAAATCACAGAACTGTAACAATGATTGCTCGAGAATCGGAATTAATTT
CCTTTGCGGGAAAACTGTGAGGAATGGCAGGGAAATACGCTGTACCTATA
GGAATCCTTGCGAAATGCATTTGCATGCCTGCCAGAAACGGGAGGAGTGG
AGAAAAGATACAACAGGTCGATGCACACGCGACTCGGAGGAATGCAGACG
GTAGGGGGAAAATTACCAGGCGCAGAAGAAGCAGCTGAATATTTTTAAGA
ATGTATAAATATTGACACAATTGACAGGGCGAAAAATAAAAAGTAAAATT
TATTACAGTCTCTGAAAAAAAAAAAAAAAA
IP17431.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:04:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34280-RA | 380 | CG34280-RA | 13..380 | 1..368 | 1840 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:06:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 13227872..13228066 | 195..1 | 975 | 100 | Minus |
chr3R | 27901430 | chr3R | 13227632..13227801 | 364..195 | 850 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:06:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 17403512..17403706 | 195..1 | 975 | 100 | Minus |
3R | 32079331 | 3R | 17403268..17403441 | 368..195 | 870 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 17144343..17144537 | 195..1 | 975 | 100 | Minus |
3R | 31820162 | 3R | 17144099..17144272 | 368..195 | 870 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-15 20:06:38 has no hits.
IP17431.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:07:19 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 13227872..13228066 | 1..195 | 100 | | Minus |
chr3R | 13227632..13227800 | 196..364 | 100 | <- | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:39 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 1..249 | 6..254 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:07 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 1..249 | 6..254 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:19:56 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 1..249 | 6..254 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:05:32 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 1..249 | 6..254 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:15:56 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 1..249 | 6..254 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:48 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 13..376 | 1..364 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:07 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 13..376 | 1..364 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:19:56 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 13..376 | 1..364 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:05:33 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 13..376 | 1..364 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:15:56 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34280-RA | 13..376 | 1..364 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:19 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17403272..17403440 | 196..364 | 100 | <- | Minus |
3R | 17403512..17403706 | 1..195 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:19 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17403272..17403440 | 196..364 | 100 | <- | Minus |
3R | 17403512..17403706 | 1..195 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:19 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17403272..17403440 | 196..364 | 100 | <- | Minus |
3R | 17403512..17403706 | 1..195 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:19:56 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 13228994..13229162 | 196..364 | 100 | <- | Minus |
arm_3R | 13229234..13229428 | 1..195 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:13 Download gff for
IP17431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 17144103..17144271 | 196..364 | 100 | <- | Minus |
3R | 17144343..17144537 | 1..195 | 100 | | Minus |
IP17431.hyp Sequence
Translation from 2 to 253
> IP17431.hyp
NMKLIILIAFLALLNLAKSQNCNNDCSRIGINFLCGKTVRNGREIRCTYR
NPCEMHLHACQKREEWRKDTTGRCTRDSEECRR*
IP17431.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34280-PA | 82 | CG34280-PA | 1..82 | 2..83 | 452 | 100 | Plus |
IP17431.pep Sequence
Translation from 2 to 253
> IP17431.pep
NMKLIILIAFLALLNLAKSQNCNNDCSRIGINFLCGKTVRNGREIRCTYR
NPCEMHLHACQKREEWRKDTTGRCTRDSEECRR*
IP17431.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:31:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16777-PA | 154 | GG16777-PA | 1..82 | 2..83 | 366 | 80.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34280-PA | 82 | CG34280-PA | 1..82 | 2..83 | 452 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:32:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL23940-PA | 84 | GL23940-PA | 19..67 | 19..68 | 144 | 58 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:32:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA27117-PA | 135 | GA27117-PA | 19..67 | 19..68 | 146 | 58 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:32:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15366-PA | 130 | GM15366-PA | 1..67 | 2..68 | 312 | 88.1 | Plus |