Clone IP17431 Report

Search the DGRC for IP17431

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:174
Well:31
Vector:pOT2
Associated Gene/TranscriptCG34280-RA
Protein status:IP17431.pep: gold
Sequenced Size:380

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34280 2008-04-29 Release 5.5 accounting
CG34280 2008-08-15 Release 5.9 accounting
CG34280 2008-12-18 5.12 accounting

Clone Sequence Records

IP17431.complete Sequence

380 bp assembled on 2006-11-28

GenBank Submission: BT029695

> IP17431.complete
CCAACATGAAGTTGATCATCCTGATCGCTTTTTTGGCTCTTCTTAATCTA
GCGAAATCACAGAACTGTAACAATGATTGCTCGAGAATCGGAATTAATTT
CCTTTGCGGGAAAACTGTGAGGAATGGCAGGGAAATACGCTGTACCTATA
GGAATCCTTGCGAAATGCATTTGCATGCCTGCCAGAAACGGGAGGAGTGG
AGAAAAGATACAACAGGTCGATGCACACGCGACTCGGAGGAATGCAGACG
GTAGGGGGAAAATTACCAGGCGCAGAAGAAGCAGCTGAATATTTTTAAGA
ATGTATAAATATTGACACAATTGACAGGGCGAAAAATAAAAAGTAAAATT
TATTACAGTCTCTGAAAAAAAAAAAAAAAA

IP17431.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG34280-RA 380 CG34280-RA 13..380 1..368 1840 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13227872..13228066 195..1 975 100 Minus
chr3R 27901430 chr3R 13227632..13227801 364..195 850 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:31:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17403512..17403706 195..1 975 100 Minus
3R 32079331 3R 17403268..17403441 368..195 870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17144343..17144537 195..1 975 100 Minus
3R 31820162 3R 17144099..17144272 368..195 870 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:06:38 has no hits.

IP17431.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:07:19 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13227872..13228066 1..195 100   Minus
chr3R 13227632..13227800 196..364 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:07:39 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 1..249 6..254 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:04:07 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 1..249 6..254 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:19:56 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 1..249 6..254 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:05:32 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 1..249 6..254 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:15:56 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 1..249 6..254 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:48 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 13..376 1..364 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:04:07 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 13..376 1..364 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:19:56 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 13..376 1..364 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:05:33 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 13..376 1..364 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:15:56 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
CG34280-RA 13..376 1..364 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:19 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17403272..17403440 196..364 100 <- Minus
3R 17403512..17403706 1..195 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:19 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17403272..17403440 196..364 100 <- Minus
3R 17403512..17403706 1..195 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:07:19 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17403272..17403440 196..364 100 <- Minus
3R 17403512..17403706 1..195 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:19:56 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13228994..13229162 196..364 100 <- Minus
arm_3R 13229234..13229428 1..195 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:13 Download gff for IP17431.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17144103..17144271 196..364 100 <- Minus
3R 17144343..17144537 1..195 100   Minus

IP17431.hyp Sequence

Translation from 2 to 253

> IP17431.hyp
NMKLIILIAFLALLNLAKSQNCNNDCSRIGINFLCGKTVRNGREIRCTYR
NPCEMHLHACQKREEWRKDTTGRCTRDSEECRR*

IP17431.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34280-PA 82 CG34280-PA 1..82 2..83 452 100 Plus

IP17431.pep Sequence

Translation from 2 to 253

> IP17431.pep
NMKLIILIAFLALLNLAKSQNCNNDCSRIGINFLCGKTVRNGREIRCTYR
NPCEMHLHACQKREEWRKDTTGRCTRDSEECRR*

IP17431.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16777-PA 154 GG16777-PA 1..82 2..83 366 80.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34280-PA 82 CG34280-PA 1..82 2..83 452 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23940-PA 84 GL23940-PA 19..67 19..68 144 58 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27117-PA 135 GA27117-PA 19..67 19..68 146 58 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15366-PA 130 GM15366-PA 1..67 2..68 312 88.1 Plus