IP17565.complete Sequence
367 bp assembled on 2009-01-20
GenBank Submission: BT029720.1
> IP17565.complete
TCGGCGGAATGACGTCTCCCTTCGACGGCATTGCCTGCTTCTGGCTGTCA
CTAGTCTGGATTCAACTGGGTATCATCAATGCCGGCCTGGAGTTCCTCAA
GGATTTCGTACCCCTTCAGCTGGTGCGGCTGAGAGAGATCGAGGACGAAG
AGCGGGAAATCGAGGGCGAGTGCACCCTGGGAGCCATCAGCATTCGTATG
TTCGCCTTTTAATGACTGCTATAGGGATTCATCTTTAATTATTATTCAAA
CTCATTATAATTACCTACTCTGACTGTTACTGTTACCTTACATTTCTAGT
TATGTTAACAAAGAAATGAAAACATTGATTAATTGTATACCTTTAAGAAT
AAAAAAAAAAAAAAAAA
IP17565.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:03:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11741-RA | 458 | CG11741-RA | 7..357 | 1..351 | 1755 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:57:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 4354482..4354831 | 350..1 | 1750 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 8528521..8528871 | 351..1 | 1755 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 8269352..8269702 | 351..1 | 1755 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 02:57:16 has no hits.
IP17565.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:58:05 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 4354482..4354831 | 1..350 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:24 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 1..204 | 9..212 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:01:41 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 1..204 | 9..212 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:44 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 1..204 | 9..212 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:30 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 1..204 | 9..212 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:26:29 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 1..204 | 9..212 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-20 10:00:19 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 7..356 | 1..350 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:01:41 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 7..356 | 1..350 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:44 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 7..356 | 1..350 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:31 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 7..356 | 1..350 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:26:29 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 7..356 | 1..350 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:05 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8528522..8528871 | 1..350 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:05 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8528522..8528871 | 1..350 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:05 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8528522..8528871 | 1..350 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:44 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 4354244..4354593 | 1..350 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:35 Download gff for
IP17565.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8269353..8269702 | 1..350 | 100 | | Minus |
IP17565.hyp Sequence
Translation from 0 to 237
> IP17565.hyp
RRNDVSLRRHCLLLAVTSLDSTGYHQCRPGVPQGFRTPSAGAAERDRGRR
AGNRGRVHPGSHQHSYVRLLMTAIGIHL*
Sequence IP17565.hyp has no blast hits.
IP17565.pep Sequence
Translation from 2 to 211
> IP17565.pep
GGMTSPFDGIACFWLSLVWIQLGIINAGLEFLKDFVPLQLVRLREIEDEE
REIEGECTLGAISIRMFAF*
IP17565.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:24:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17720-PA | 67 | GF17720-PA | 1..67 | 3..69 | 223 | 59.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:24:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG17443-PA | 67 | GG17443-PA | 1..67 | 3..69 | 316 | 91 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11741-PB | 67 | CG11741-PB | 1..67 | 3..69 | 347 | 100 | Plus |
CG11741-PA | 67 | CG11741-PA | 1..67 | 3..69 | 347 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:24:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL21544-PA | 74 | GL21544-PA | 16..74 | 11..69 | 175 | 59.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:24:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA30262-PA | 74 | GA30262-PA | 16..74 | 11..69 | 175 | 59.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:24:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26337-PA | 109 | GM26337-PA | 41..109 | 1..69 | 311 | 84.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:24:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD20863-PA | 149 | GD20863-PA | 81..149 | 1..69 | 272 | 89.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:24:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24845-PA | 67 | GE24845-PA | 1..67 | 3..69 | 325 | 92.5 | Plus |