Clone IP17565 Report

Search the DGRC for IP17565

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:175
Well:65
Vector:pOT2
Associated Gene/TranscriptCG11741-RA
Protein status:IP17565.pep: gold
Sequenced Size:367

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11741 2008-04-29 Release 5.5 accounting
CG11741 2008-08-15 Release 5.9 accounting
CG11741 2008-12-18 5.12 accounting

Clone Sequence Records

IP17565.complete Sequence

367 bp assembled on 2009-01-20

GenBank Submission: BT029720.1

> IP17565.complete
TCGGCGGAATGACGTCTCCCTTCGACGGCATTGCCTGCTTCTGGCTGTCA
CTAGTCTGGATTCAACTGGGTATCATCAATGCCGGCCTGGAGTTCCTCAA
GGATTTCGTACCCCTTCAGCTGGTGCGGCTGAGAGAGATCGAGGACGAAG
AGCGGGAAATCGAGGGCGAGTGCACCCTGGGAGCCATCAGCATTCGTATG
TTCGCCTTTTAATGACTGCTATAGGGATTCATCTTTAATTATTATTCAAA
CTCATTATAATTACCTACTCTGACTGTTACTGTTACCTTACATTTCTAGT
TATGTTAACAAAGAAATGAAAACATTGATTAATTGTATACCTTTAAGAAT
AAAAAAAAAAAAAAAAA

IP17565.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG11741-RA 458 CG11741-RA 7..357 1..351 1755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4354482..4354831 350..1 1750 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8528521..8528871 351..1 1755 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8269352..8269702 351..1 1755 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:57:16 has no hits.

IP17565.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:58:05 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4354482..4354831 1..350 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:24 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 1..204 9..212 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:01:41 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 1..204 9..212 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:44 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 1..204 9..212 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:30 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 1..204 9..212 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:26:29 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 1..204 9..212 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-20 10:00:19 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 7..356 1..350 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:01:41 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 7..356 1..350 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:44 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 7..356 1..350 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:31 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 7..356 1..350 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:26:29 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 7..356 1..350 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:05 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8528522..8528871 1..350 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:05 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8528522..8528871 1..350 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:05 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8528522..8528871 1..350 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:44 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4354244..4354593 1..350 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:35 Download gff for IP17565.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8269353..8269702 1..350 100   Minus

IP17565.hyp Sequence

Translation from 0 to 237

> IP17565.hyp
RRNDVSLRRHCLLLAVTSLDSTGYHQCRPGVPQGFRTPSAGAAERDRGRR
AGNRGRVHPGSHQHSYVRLLMTAIGIHL*
Sequence IP17565.hyp has no blast hits.

IP17565.pep Sequence

Translation from 2 to 211

> IP17565.pep
GGMTSPFDGIACFWLSLVWIQLGIINAGLEFLKDFVPLQLVRLREIEDEE
REIEGECTLGAISIRMFAF*

IP17565.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17720-PA 67 GF17720-PA 1..67 3..69 223 59.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17443-PA 67 GG17443-PA 1..67 3..69 316 91 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG11741-PB 67 CG11741-PB 1..67 3..69 347 100 Plus
CG11741-PA 67 CG11741-PA 1..67 3..69 347 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21544-PA 74 GL21544-PA 16..74 11..69 175 59.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30262-PA 74 GA30262-PA 16..74 11..69 175 59.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26337-PA 109 GM26337-PA 41..109 1..69 311 84.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20863-PA 149 GD20863-PA 81..149 1..69 272 89.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24845-PA 67 GE24845-PA 1..67 3..69 325 92.5 Plus