IP17567.complete Sequence
340 bp assembled on 2006-11-30
GenBank Submission: BT029721
> IP17567.complete
TGGAACGAAATGGGTCACCTGCAGTTGGATTTCCATTCCATACCTAAGCT
CCATGGCAGGGAGAACTATTGGCAGTGGCGCATCCTCCTGAAGACCTTTC
TGGAGGCCAACGATCTGTGGAAGCACAACGAACCGAAGGAGAGCCCAGAA
ACCAAATTCCTGATTTTGGCCAGCGTTACGGCCGATAAGATTGAGCCATC
CTACGATGATCAAAGCTGTTCGTACATTTTCCAAAACATGGAGAGTCGAT
TCGGGCCTTTTAGTTAAAAATTGAATAAATATACATATATTTATGTTTTG
ACCATTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
IP17567.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:03:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34301.b | 635 | CG34301.b | 326..633 | 1..308 | 1540 | 100 | Plus |
CG34301.a | 833 | CG34301.a | 326..633 | 1..308 | 1540 | 100 | Plus |
CG34301-RA | 904 | CG34301-RA | 383..690 | 1..308 | 1540 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:57:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 4599616..4599783 | 140..307 | 840 | 100 | Plus |
chr3R | 27901430 | chr3R | 4599408..4599548 | 1..141 | 705 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:57:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 8773643..8773811 | 140..308 | 845 | 100 | Plus |
3R | 32079331 | 3R | 8773435..8773575 | 1..141 | 705 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 8514474..8514642 | 140..308 | 845 | 100 | Plus |
3R | 31820162 | 3R | 8514266..8514406 | 1..141 | 705 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 19:57:53 has no hits.
IP17567.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:58:40 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 4599408..4599548 | 1..141 | 100 | -> | Plus |
chr3R | 4599618..4599783 | 142..307 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:25 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..258 | 10..267 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:05 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..258 | 10..267 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:47 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..258 | 10..267 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:11 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..258 | 10..267 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:48:00 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..258 | 10..267 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:20 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..307 | 1..307 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:05 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..307 | 1..307 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:47 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..307 | 1..307 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:11 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..307 | 1..307 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:00 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34301-RA | 1..307 | 1..307 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:40 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8773435..8773575 | 1..141 | 100 | -> | Plus |
3R | 8773645..8773810 | 142..307 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:40 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8773435..8773575 | 1..141 | 100 | -> | Plus |
3R | 8773645..8773810 | 142..307 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:40 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8773435..8773575 | 1..141 | 100 | -> | Plus |
3R | 8773645..8773810 | 142..307 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:47 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 4599157..4599297 | 1..141 | 100 | -> | Plus |
arm_3R | 4599367..4599532 | 142..307 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:50 Download gff for
IP17567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8514266..8514406 | 1..141 | 100 | -> | Plus |
3R | 8514476..8514641 | 142..307 | 100 | | Plus |
IP17567.hyp Sequence
Translation from 0 to 266
> IP17567.hyp
WNEMGHLQLDFHSIPKLHGRENYWQWRILLKTFLEANDLWKHNEPKESPE
TKFLILASVTADKIEPSYDDQSCSYIFQNMESRFGPFS*
IP17567.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34301-PA | 85 | CG34301-PA | 1..85 | 4..88 | 467 | 100 | Plus |
CG42446-PA | 123 | CG42446-PA | 39..109 | 14..84 | 169 | 42.3 | Plus |
IP17567.pep Sequence
Translation from 0 to 266
> IP17567.pep
WNEMGHLQLDFHSIPKLHGRENYWQWRILLKTFLEANDLWKHNEPKESPE
TKFLILASVTADKIEPSYDDQSCSYIFQNMESRFGPFS*
IP17567.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:57:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF18190-PA | 87 | GF18190-PA | 1..85 | 4..87 | 366 | 75.3 | Plus |
Dana\GF16521-PA | 108 | GF16521-PA | 25..95 | 14..84 | 158 | 39.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:57:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13051-PA | 53 | GG13051-PA | 1..52 | 4..58 | 238 | 83.6 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:57:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH18580-PA | 83 | GH18580-PA | 1..83 | 4..87 | 264 | 54.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34301-PA | 85 | CG34301-PA | 1..85 | 4..88 | 467 | 100 | Plus |
CG42446-PA | 123 | CG42446-PA | 39..109 | 14..84 | 169 | 42.3 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:57:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI24510-PA | 87 | GI24510-PA | 5..87 | 5..87 | 276 | 55.4 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:57:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL12483-PA | 85 | GL12483-PA | 1..85 | 4..88 | 332 | 65.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:57:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA27523-PA | 85 | GA27523-PA | 1..85 | 4..88 | 333 | 65.9 | Plus |
Dpse\GA30255-PA | 144 | GA30255-PA | 41..133 | 14..84 | 136 | 32.3 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:57:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ22683-PA | 88 | GJ22683-PA | 6..88 | 5..87 | 287 | 59 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:57:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25907-PA | 85 | GE25907-PA | 1..85 | 4..88 | 451 | 97.6 | Plus |