Clone IP17567 Report

Search the DGRC for IP17567

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:175
Well:67
Vector:pOT2
Associated Gene/TranscriptCG34301-RA
Protein status:IP17567.pep: gold
Sequenced Size:340

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34301 2008-04-29 Release 5.5 accounting
CG34301 2008-08-15 Release 5.9 accounting
CG34301 2008-12-18 5.12 accounting

Clone Sequence Records

IP17567.complete Sequence

340 bp assembled on 2006-11-30

GenBank Submission: BT029721

> IP17567.complete
TGGAACGAAATGGGTCACCTGCAGTTGGATTTCCATTCCATACCTAAGCT
CCATGGCAGGGAGAACTATTGGCAGTGGCGCATCCTCCTGAAGACCTTTC
TGGAGGCCAACGATCTGTGGAAGCACAACGAACCGAAGGAGAGCCCAGAA
ACCAAATTCCTGATTTTGGCCAGCGTTACGGCCGATAAGATTGAGCCATC
CTACGATGATCAAAGCTGTTCGTACATTTTCCAAAACATGGAGAGTCGAT
TCGGGCCTTTTAGTTAAAAATTGAATAAATATACATATATTTATGTTTTG
ACCATTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP17567.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301.b 635 CG34301.b 326..633 1..308 1540 100 Plus
CG34301.a 833 CG34301.a 326..633 1..308 1540 100 Plus
CG34301-RA 904 CG34301-RA 383..690 1..308 1540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4599616..4599783 140..307 840 100 Plus
chr3R 27901430 chr3R 4599408..4599548 1..141 705 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8773643..8773811 140..308 845 100 Plus
3R 32079331 3R 8773435..8773575 1..141 705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8514474..8514642 140..308 845 100 Plus
3R 31820162 3R 8514266..8514406 1..141 705 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:57:53 has no hits.

IP17567.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:58:40 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4599408..4599548 1..141 100 -> Plus
chr3R 4599618..4599783 142..307 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:25 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..258 10..267 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:02:05 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..258 10..267 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:01:47 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..258 10..267 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:02:11 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..258 10..267 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:48:00 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..258 10..267 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:20 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..307 1..307 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:02:05 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..307 1..307 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:01:47 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..307 1..307 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:02:11 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..307 1..307 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:00 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
CG34301-RA 1..307 1..307 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:40 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8773435..8773575 1..141 100 -> Plus
3R 8773645..8773810 142..307 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:40 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8773435..8773575 1..141 100 -> Plus
3R 8773645..8773810 142..307 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:58:40 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8773435..8773575 1..141 100 -> Plus
3R 8773645..8773810 142..307 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:01:47 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4599157..4599297 1..141 100 -> Plus
arm_3R 4599367..4599532 142..307 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:50 Download gff for IP17567.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8514266..8514406 1..141 100 -> Plus
3R 8514476..8514641 142..307 100   Plus

IP17567.hyp Sequence

Translation from 0 to 266

> IP17567.hyp
WNEMGHLQLDFHSIPKLHGRENYWQWRILLKTFLEANDLWKHNEPKESPE
TKFLILASVTADKIEPSYDDQSCSYIFQNMESRFGPFS*

IP17567.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301-PA 85 CG34301-PA 1..85 4..88 467 100 Plus
CG42446-PA 123 CG42446-PA 39..109 14..84 169 42.3 Plus

IP17567.pep Sequence

Translation from 0 to 266

> IP17567.pep
WNEMGHLQLDFHSIPKLHGRENYWQWRILLKTFLEANDLWKHNEPKESPE
TKFLILASVTADKIEPSYDDQSCSYIFQNMESRFGPFS*

IP17567.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18190-PA 87 GF18190-PA 1..85 4..87 366 75.3 Plus
Dana\GF16521-PA 108 GF16521-PA 25..95 14..84 158 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13051-PA 53 GG13051-PA 1..52 4..58 238 83.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18580-PA 83 GH18580-PA 1..83 4..87 264 54.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34301-PA 85 CG34301-PA 1..85 4..88 467 100 Plus
CG42446-PA 123 CG42446-PA 39..109 14..84 169 42.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24510-PA 87 GI24510-PA 5..87 5..87 276 55.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12483-PA 85 GL12483-PA 1..85 4..88 332 65.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27523-PA 85 GA27523-PA 1..85 4..88 333 65.9 Plus
Dpse\GA30255-PA 144 GA30255-PA 41..133 14..84 136 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22683-PA 88 GJ22683-PA 6..88 5..87 287 59 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25907-PA 85 GE25907-PA 1..85 4..88 451 97.6 Plus