IP17576.complete Sequence
822 bp assembled on 2006-11-28
GenBank Submission: BT029722
> IP17576.complete
CGAAATCGCATAAAAAACAAAGTGACACCCCATGCCACAAATAATGAATT
CTAAGGACAAACGAAACCCAAATTATTCCGGCGGGAACAGCGGCGAGGAA
GAGGATTCCTGGATGAACAGCTATTACACCTGCCTGGTGTGCATGCAGAC
TGCTGAATCGCCGAGGGTCAGTTTTTGCGGCCACCACTTCTGCTCCCAGT
GCATATACAACTGGATTAGGAGTCAGAAATATCAGGCCAAATGCCCCTAC
TGCCAGTCCCTGATCGGTGAGAACACCCTCATCACTATCACCATGCGAAG
ACGAAGAACGTACTTTCGTGCAAATCCTTTGTGGAGCACCGCCGCCAGAT
GCGCATGAGCAAAGACTGTTTAACCGAAAACATCTTTTTGCCGGAGGCCG
GCATGTTCACACGTGGCTATATCAAATATCCGCCGGACCCTATGCCAAGG
ATCAAGCCTTTGCCGCCCCAGATGCTTCAACAGTGGTCACGTTATCCCAT
AGTGCGCATTTTCCTTACACCCTCGCTGCACCAGCGCTTCATTAACTTCG
TTATCTTTCTGTTCATGCTGGCCATGTACCTACACGCGGCAGTGACACCG
TCTTTACTATTGTGAGCCAGTGAGACGTAGCACCCAACAAATCTCCACTA
ACAAATTGTCTTTTGAATTTCGACTTGTTATTGTCTGAAATGGCATCCAA
GAACATCTAGTTTCTGTGGCCCCAGCAGTGCAGTTCTGTGAGATTTACCC
TCTTACGTAAATAAAATTTTCTTTTGTGGGCATAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA
IP17576.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:05:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34308-RA | 785 | CG34308-RA | 1..785 | 1..785 | 3925 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:01:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 8914499..8915282 | 1..783 | 3855 | 99.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:01:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13089299..13090083 | 1..785 | 3925 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 12830130..12830914 | 1..785 | 3925 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 17:01:10 has no hits.
IP17576.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:02:29 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 8914499..8915282 | 1..783 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:29 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RA | 1..327 | 32..358 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:03 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RA | 1..327 | 32..358 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:14:04 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RA | 1..327 | 32..358 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:08:26 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RA | 1..327 | 32..358 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:52 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RB | 1..216 | 143..358 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:43 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RA | 1..783 | 1..783 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:03 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RA | 1..783 | 1..783 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:14:04 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RA | 1..783 | 1..783 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:08:27 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RA | 1..783 | 1..783 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:52 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34308-RB | 58..840 | 1..783 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:29 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13089299..13090081 | 1..783 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:29 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13089299..13090081 | 1..783 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:29 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13089299..13090081 | 1..783 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:14:04 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8915021..8915803 | 1..783 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:51 Download gff for
IP17576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12830130..12830912 | 1..783 | 100 | | Plus |
IP17576.hyp Sequence
Translation from 31 to 357
> IP17576.hyp
MPQIMNSKDKRNPNYSGGNSGEEEDSWMNSYYTCLVCMQTAESPRVSFCG
HHFCSQCIYNWIRSQKYQAKCPYCQSLIGENTLITITMRRRRTYFRANPL
WSTAARCA*
IP17576.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34308-PB | 71 | CG34308-PB | 1..71 | 38..108 | 398 | 100 | Plus |
CG32847-PB | 164 | CG32847-PB | 9..97 | 25..105 | 148 | 33.7 | Plus |
IP17576.pep Sequence
Translation from 31 to 357
> IP17576.pep
MPQIMNSKDKRNPNYSGGNSGEEEDSWMNSYYTCLVCMQTAESPRVSFCG
HHFCSQCIYNWIRSQKYQAKCPYCQSLIGENTLITITMRRRRTYFRANPL
WSTAARCA*
IP17576.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:46:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17582-PA | 1584 | GF17582-PA | 179..236 | 29..86 | 261 | 70.7 | Plus |
Dana\GF19745-PA | 252 | GF19745-PA | 81..151 | 19..89 | 137 | 33.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34308-PC | 194 | CG34308-PC | 1..86 | 1..86 | 489 | 100 | Plus |
CG32847-PB | 164 | CG32847-PB | 9..97 | 25..105 | 148 | 33.7 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:46:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL14112-PA | 251 | GL14112-PA | 75..154 | 7..89 | 141 | 31.3 | Plus |
Dper\GL22919-PA | 280 | GL22919-PA | 104..183 | 7..89 | 140 | 31.3 | Plus |
Dper\GL14111-PA | 280 | GL14111-PA | 104..183 | 7..89 | 140 | 31.3 | Plus |
Dper\GL22918-PA | 241 | GL22918-PA | 65..144 | 7..89 | 139 | 31.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:46:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA28677-PA | 242 | GA28677-PA | 104..183 | 7..89 | 139 | 31.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:46:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25509-PA | 165 | GM25509-PA | 8..95 | 23..102 | 140 | 33 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:46:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ18601-PA | 272 | GJ18601-PA | 104..178 | 14..89 | 136 | 32.9 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:46:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK22409-PA | 1605 | GK22409-PA | 162..232 | 19..86 | 231 | 53.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:46:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE26249-PA | 1578 | GE26249-PA | 143..239 | 9..105 | 312 | 60.8 | Plus |