Clone IP17577 Report

Search the DGRC for IP17577

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:175
Well:77
Vector:pOT2
Associated Gene/TranscriptCG34309-RA
Protein status:IP17577.pep: gold
Sequenced Size:612

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34309 2008-04-29 Release 5.5 accounting
CG34309 2008-08-15 Release 5.9 accounting
CG34309 2008-12-18 5.12 accounting

Clone Sequence Records

IP17577.complete Sequence

612 bp assembled on 2006-11-30

GenBank Submission: BT029723

> IP17577.complete
CTAGAGTGGAGCTCATTTTCAAAGGATTTCCAAAATGAAACACCAACAAG
TTACGGTGGACTATTGGACCATGTTTAAGACATCGGGATTGTGTCTTTTA
CTGGCCATTTGCGGATTTGTACTTCTTAAAATGGTGCAGACCATTTTCTG
GCTACCTGGACATCTGAAGAAGAACCAGCAGCGCCTGGAGGATCTGGCCA
AAATCTATGCCAAGGATATTAGCGAGGAAGAGAGGGACGAGATCGAGAAA
CTGTTCAACAGTAAGGAGCCGCTGACTGAAGAACGAATCAACCAGTTGCT
CGACAAGCCAGAGACTTCAGAGCCAAAAAAGGAGCAATAGTTAAATAAAT
TGATTCGCATGTTTTATATATATATATATATATTTATGTATATTGAGTGT
ATAATCGATAATTTGTTGATACAGGTTCTAGTTCTTACTTGCATATCGTA
TATGTAACTCGCAACACAATCAATCGTTTAACCAATCCATCAATAATGCC
TGTAACGCTCAATTATTCAGGGAGGGGGACAACAAATAGAATAATAACTA
TTCACGAAAGTCGCTCGTCTGTGGAGCGGTTACAAGTTAAAAAAAAAAAA
AAAAAAAAAAAA

IP17577.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG34309-RA 676 CG34309-RA 22..610 1..589 2945 100 Plus
CG34309.b 1046 CG34309.b 392..980 1..589 2945 100 Plus
CG34309.a 1010 CG34309.a 356..944 1..589 2945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9198050..9198509 130..588 2135 98.5 Plus
chr3R 27901430 chr3R 9197812..9197940 1..129 645 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13372868..13373327 130..589 2300 100 Plus
3R 32079331 3R 13372630..13372758 1..129 645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13113699..13114158 130..589 2300 100 Plus
3R 31820162 3R 13113461..13113589 1..129 645 100 Plus
Blast to na_te.dros performed 2019-03-15 23:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 3818..3897 434..360 125 68.8 Minus
Stalker 7256 Stalker STALKER 7256bp 3712..3791 434..360 125 68.8 Minus

IP17577.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:13:23 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9197812..9197940 1..129 100 -> Plus
chr3R 9198050..9198509 130..588 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:31 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..306 35..340 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:15:17 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..306 35..340 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:27 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..306 35..340 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:25:50 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..306 35..340 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:51 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..306 35..340 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:44:02 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:15:17 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:27 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:25:50 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..588 1..588 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:51 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
CG34309-RA 1..588 1..588 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:23 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13372630..13372758 1..129 100 -> Plus
3R 13372868..13373326 130..588 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:23 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13372630..13372758 1..129 100 -> Plus
3R 13372868..13373326 130..588 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:23 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13372630..13372758 1..129 100 -> Plus
3R 13372868..13373326 130..588 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:27 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9198352..9198480 1..129 100 -> Plus
arm_3R 9198590..9199048 130..588 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:45:57 Download gff for IP17577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13113461..13113589 1..129 100 -> Plus
3R 13113699..13114157 130..588 100   Plus

IP17577.hyp Sequence

Translation from 34 to 339

> IP17577.hyp
MKHQQVTVDYWTMFKTSGLCLLLAICGFVLLKMVQTIFWLPGHLKKNQQR
LEDLAKIYAKDISEEERDEIEKLFNSKEPLTEERINQLLDKPETSEPKKE
Q*

IP17577.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34309-PA 101 CG34309-PA 1..101 1..101 527 100 Plus

IP17577.pep Sequence

Translation from 34 to 339

> IP17577.pep
MKHQQVTVDYWTMFKTSGLCLLLAICGFVLLKMVQTIFWLPGHLKKNQQR
LEDLAKIYAKDISEEERDEIEKLFNSKEPLTEERINQLLDKPETSEPKKE
Q*

IP17577.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17598-PA 101 GF17598-PA 1..101 1..101 382 83.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19632-PA 101 GG19632-PA 1..101 1..101 501 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19042-PA 104 GH19042-PA 1..99 1..99 358 65.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34309-PA 101 CG34309-PA 1..101 1..101 527 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24336-PA 103 GI24336-PA 1..103 1..101 367 68.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24471-PA 102 GL24471-PA 1..102 1..101 436 82.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26621-PA 102 GA26621-PA 1..102 1..101 436 82.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24105-PA 101 GM24105-PA 1..101 1..101 509 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18904-PA 101 GD18904-PA 1..101 1..101 516 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10421-PA 103 GJ10421-PA 1..103 1..101 374 68 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13940-PA 105 GK13940-PA 1..104 1..100 337 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26268-PA 101 GE26268-PA 1..101 1..101 503 93.1 Plus