BDGP Sequence Production Resources |
Search the DGRC for IP17577
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 175 |
Well: | 77 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34309-RA |
Protein status: | IP17577.pep: gold |
Sequenced Size: | 612 |
Gene | Date | Evidence |
---|---|---|
CG34309 | 2008-04-29 | Release 5.5 accounting |
CG34309 | 2008-08-15 | Release 5.9 accounting |
CG34309 | 2008-12-18 | 5.12 accounting |
612 bp assembled on 2006-11-30
GenBank Submission: BT029723
> IP17577.complete CTAGAGTGGAGCTCATTTTCAAAGGATTTCCAAAATGAAACACCAACAAG TTACGGTGGACTATTGGACCATGTTTAAGACATCGGGATTGTGTCTTTTA CTGGCCATTTGCGGATTTGTACTTCTTAAAATGGTGCAGACCATTTTCTG GCTACCTGGACATCTGAAGAAGAACCAGCAGCGCCTGGAGGATCTGGCCA AAATCTATGCCAAGGATATTAGCGAGGAAGAGAGGGACGAGATCGAGAAA CTGTTCAACAGTAAGGAGCCGCTGACTGAAGAACGAATCAACCAGTTGCT CGACAAGCCAGAGACTTCAGAGCCAAAAAAGGAGCAATAGTTAAATAAAT TGATTCGCATGTTTTATATATATATATATATATTTATGTATATTGAGTGT ATAATCGATAATTTGTTGATACAGGTTCTAGTTCTTACTTGCATATCGTA TATGTAACTCGCAACACAATCAATCGTTTAACCAATCCATCAATAATGCC TGTAACGCTCAATTATTCAGGGAGGGGGACAACAAATAGAATAATAACTA TTCACGAAAGTCGCTCGTCTGTGGAGCGGTTACAAGTTAAAAAAAAAAAA AAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 9197812..9197940 | 1..129 | 100 | -> | Plus |
chr3R | 9198050..9198509 | 130..588 | 92 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..306 | 35..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..306 | 35..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..306 | 35..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..306 | 35..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..306 | 35..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..588 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..588 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..588 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..588 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34309-RA | 1..588 | 1..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13372630..13372758 | 1..129 | 100 | -> | Plus |
3R | 13372868..13373326 | 130..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13372630..13372758 | 1..129 | 100 | -> | Plus |
3R | 13372868..13373326 | 130..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13372630..13372758 | 1..129 | 100 | -> | Plus |
3R | 13372868..13373326 | 130..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 9198352..9198480 | 1..129 | 100 | -> | Plus |
arm_3R | 9198590..9199048 | 130..588 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13113461..13113589 | 1..129 | 100 | -> | Plus |
3R | 13113699..13114157 | 130..588 | 100 | Plus |
Translation from 34 to 339
> IP17577.hyp MKHQQVTVDYWTMFKTSGLCLLLAICGFVLLKMVQTIFWLPGHLKKNQQR LEDLAKIYAKDISEEERDEIEKLFNSKEPLTEERINQLLDKPETSEPKKE Q*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34309-PA | 101 | CG34309-PA | 1..101 | 1..101 | 527 | 100 | Plus |
Translation from 34 to 339
> IP17577.pep MKHQQVTVDYWTMFKTSGLCLLLAICGFVLLKMVQTIFWLPGHLKKNQQR LEDLAKIYAKDISEEERDEIEKLFNSKEPLTEERINQLLDKPETSEPKKE Q*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17598-PA | 101 | GF17598-PA | 1..101 | 1..101 | 382 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19632-PA | 101 | GG19632-PA | 1..101 | 1..101 | 501 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19042-PA | 104 | GH19042-PA | 1..99 | 1..99 | 358 | 65.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34309-PA | 101 | CG34309-PA | 1..101 | 1..101 | 527 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24336-PA | 103 | GI24336-PA | 1..103 | 1..101 | 367 | 68.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24471-PA | 102 | GL24471-PA | 1..102 | 1..101 | 436 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26621-PA | 102 | GA26621-PA | 1..102 | 1..101 | 436 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24105-PA | 101 | GM24105-PA | 1..101 | 1..101 | 509 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18904-PA | 101 | GD18904-PA | 1..101 | 1..101 | 516 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10421-PA | 103 | GJ10421-PA | 1..103 | 1..101 | 374 | 68 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13940-PA | 105 | GK13940-PA | 1..104 | 1..100 | 337 | 72.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26268-PA | 101 | GE26268-PA | 1..101 | 1..101 | 503 | 93.1 | Plus |