BDGP Sequence Production Resources |
Search the DGRC for IP17594
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 175 |
Well: | 94 |
Vector: | pOT2 |
Associated Gene/Transcript | CG42246-RA |
Protein status: | IP17594.pep: gold |
Sequenced Size: | 593 |
Gene | Date | Evidence |
---|---|---|
CG42246 | 2008-08-15 | Release 5.9 accounting |
CG42246 | 2008-12-18 | 5.12 accounting |
593 bp assembled on 2006-12-04
GenBank Submission: BT029726
> IP17594.complete TTCAACGTAAAATGTTCTGCGAGGCGTTTTAACTCCGGCCTTTATTTCTA ACGATTTTTCAATTCCGGTCATGGCTTTTCTTTTTAAACTATTTACCTTC TTGGCGGTGGCCGCCATTTTGATCCAAATGACACTTGCACTGGAGTTTAT GGATGAAGACTTTCTGGCAAACGATGACGGTCATCACTTGGACGAAGAGT CCGCTGAAGTGCCTGGTATTTTGACTGGTTATACCAGAGATACGATCGCT CACTTTAATCCTCGCAAAGTAGATGGGGGATTTCGACAATTGTGGGAACG TGTTCCCCTTCAAAAAGTCGATGATATTAAGCGGAGATAGGAAAACTTAC TCATTCCTTATACTCGATACTCCAGTTGATTACCTACAATGTGAAAAATA TTTAAAATTATTATAATTTAAAAAATATTTTTATCATTTTTTTTTTAATG CTATTTATGATATTATTTGATATGAAAATATTAAGAAAAAAAAACATGTC AGTTAATATTTATTATACTTTTAAATCGTAGTGGGTGGTTGGAAAGTTTG AAGCCTATATTAAAAGAACATTAATCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42246-RA | 667 | CG42246-RA | 90..667 | 1..577 | 2850 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 3915..3979 | 175..113 | 121 | 69.2 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 7303383..7303645 | 131..393 | 100 | <- | Minus |
chrX | 7303708..7303837 | 1..130 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..270 | 71..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..270 | 71..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..270 | 71..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..270 | 71..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..270 | 71..340 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..578 | 1..577 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..578 | 1..577 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..578 | 1..577 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..578 | 1..577 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42246-RA | 1..578 | 1..577 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7411267..7411714 | 131..577 | 99 | <- | Minus |
X | 7411777..7411906 | 1..130 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7411267..7411714 | 131..577 | 99 | <- | Minus |
X | 7411777..7411906 | 1..130 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7411267..7411714 | 131..577 | 99 | <- | Minus |
X | 7411777..7411906 | 1..130 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 7305810..7305939 | 1..130 | 100 | Minus | |
arm_X | 7305300..7305747 | 131..577 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 7419365..7419812 | 131..577 | 99 | <- | Minus |
X | 7419875..7420004 | 1..130 | 100 | Minus |
Translation from 70 to 339
> IP17594.hyp MAFLFKLFTFLAVAAILIQMTLALEFMDEDFLANDDGHHLDEESAEVPGI LTGYTRDTIAHFNPRKVDGGFRQLWERVPLQKVDDIKRR*
Translation from 70 to 339
> IP17594.pep MAFLFKLFTFLAVAAILIQMTLALEFMDEDFLANDDGHHLDEESAEVPGI LTGYTRDTIAHFNPRKVDGGFRQLWERVPLQKVDDIKRR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21130-PA | 89 | GF21130-PA | 1..89 | 1..88 | 293 | 71.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17622-PA | 90 | GG17622-PA | 1..90 | 1..89 | 406 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12844-PA | 97 | GH12844-PA | 28..97 | 18..89 | 185 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42246-PB | 89 | CG42246-PB | 1..89 | 1..89 | 462 | 100 | Plus |
CG42246-PA | 89 | CG42246-PA | 1..89 | 1..89 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14932-PA | 85 | GI14932-PA | 15..85 | 21..89 | 174 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14621-PA | 99 | GL14621-PA | 26..99 | 17..89 | 278 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28210-PA | 99 | GA28210-PA | 28..99 | 19..89 | 276 | 73.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17469-PA | 89 | GM17469-PA | 1..89 | 1..89 | 450 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16155-PA | 89 | GD16155-PA | 1..89 | 1..89 | 446 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18962-PA | 100 | GJ18962-PA | 28..100 | 19..89 | 195 | 54.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16469-PA | 93 | GK16469-PA | 22..93 | 19..89 | 210 | 58.1 | Plus |