Clone IP17594 Report

Search the DGRC for IP17594

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:175
Well:94
Vector:pOT2
Associated Gene/TranscriptCG42246-RA
Protein status:IP17594.pep: gold
Sequenced Size:593

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG42246 2008-08-15 Release 5.9 accounting
CG42246 2008-12-18 5.12 accounting

Clone Sequence Records

IP17594.complete Sequence

593 bp assembled on 2006-12-04

GenBank Submission: BT029726

> IP17594.complete
TTCAACGTAAAATGTTCTGCGAGGCGTTTTAACTCCGGCCTTTATTTCTA
ACGATTTTTCAATTCCGGTCATGGCTTTTCTTTTTAAACTATTTACCTTC
TTGGCGGTGGCCGCCATTTTGATCCAAATGACACTTGCACTGGAGTTTAT
GGATGAAGACTTTCTGGCAAACGATGACGGTCATCACTTGGACGAAGAGT
CCGCTGAAGTGCCTGGTATTTTGACTGGTTATACCAGAGATACGATCGCT
CACTTTAATCCTCGCAAAGTAGATGGGGGATTTCGACAATTGTGGGAACG
TGTTCCCCTTCAAAAAGTCGATGATATTAAGCGGAGATAGGAAAACTTAC
TCATTCCTTATACTCGATACTCCAGTTGATTACCTACAATGTGAAAAATA
TTTAAAATTATTATAATTTAAAAAATATTTTTATCATTTTTTTTTTAATG
CTATTTATGATATTATTTGATATGAAAATATTAAGAAAAAAAAACATGTC
AGTTAATATTTATTATACTTTTAAATCGTAGTGGGTGGTTGGAAAGTTTG
AAGCCTATATTAAAAGAACATTAATCCAAAAAAAAAAAAAAAA

IP17594.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-RA 667 CG42246-RA 90..667 1..577 2850 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7303198..7303646 577..130 2195 99.8 Minus
chrX 22417052 chrX 7303708..7303837 130..1 650 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7411264..7411715 580..130 2210 99.8 Minus
X 23542271 X 7411777..7411906 130..1 650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7419362..7419813 580..130 2220 99.7 Minus
X 23527363 X 7419875..7420004 130..1 650 100 Minus
Blast to na_te.dros performed 2019-03-16 06:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 3915..3979 175..113 121 69.2 Minus

IP17594.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:09:49 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7303383..7303645 131..393 100 <- Minus
chrX 7303708..7303837 1..130 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:39 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..270 71..340 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:52 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..270 71..340 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:15:49 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..270 71..340 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:35 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..270 71..340 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:16:02 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..270 71..340 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:51:43 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..578 1..577 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:52 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..578 1..577 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:15:49 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..578 1..577 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:35 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..578 1..577 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:16:02 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
CG42246-RA 1..578 1..577 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:09:49 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
X 7411267..7411714 131..577 99 <- Minus
X 7411777..7411906 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:09:49 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
X 7411267..7411714 131..577 99 <- Minus
X 7411777..7411906 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:09:49 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
X 7411267..7411714 131..577 99 <- Minus
X 7411777..7411906 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:15:49 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7305810..7305939 1..130 100   Minus
arm_X 7305300..7305747 131..577 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:57:38 Download gff for IP17594.complete
Subject Subject Range Query Range Percent Splice Strand
X 7419365..7419812 131..577 99 <- Minus
X 7419875..7420004 1..130 100   Minus

IP17594.hyp Sequence

Translation from 70 to 339

> IP17594.hyp
MAFLFKLFTFLAVAAILIQMTLALEFMDEDFLANDDGHHLDEESAEVPGI
LTGYTRDTIAHFNPRKVDGGFRQLWERVPLQKVDDIKRR*

IP17594.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-PB 89 CG42246-PB 1..89 1..89 462 100 Plus
CG42246-PA 89 CG42246-PA 1..89 1..89 462 100 Plus

IP17594.pep Sequence

Translation from 70 to 339

> IP17594.pep
MAFLFKLFTFLAVAAILIQMTLALEFMDEDFLANDDGHHLDEESAEVPGI
LTGYTRDTIAHFNPRKVDGGFRQLWERVPLQKVDDIKRR*

IP17594.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21130-PA 89 GF21130-PA 1..89 1..88 293 71.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17622-PA 90 GG17622-PA 1..90 1..89 406 86.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12844-PA 97 GH12844-PA 28..97 18..89 185 53.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42246-PB 89 CG42246-PB 1..89 1..89 462 100 Plus
CG42246-PA 89 CG42246-PA 1..89 1..89 462 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14932-PA 85 GI14932-PA 15..85 21..89 174 53.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14621-PA 99 GL14621-PA 26..99 17..89 278 71.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28210-PA 99 GA28210-PA 28..99 19..89 276 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17469-PA 89 GM17469-PA 1..89 1..89 450 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16155-PA 89 GD16155-PA 1..89 1..89 446 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18962-PA 100 GJ18962-PA 28..100 19..89 195 54.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16469-PA 93 GK16469-PA 22..93 19..89 210 58.1 Plus