IP17603.complete Sequence
448 bp assembled on 2007-01-15
GenBank Submission: BT030145
> IP17603.complete
CAAAGGTCGCATTTTAGTTTTCCAAATTCCCCCGAAATTATAACGTAAGC
TCTTTGGCTGGACTTTTCAAAATTGATAAACCAAAAATGTCCAACAACAA
GGCATCCTCTTCCCGAGGCCGACATCCTGGGATGCAGTTCAGCACTGCCA
TGGGAACGCCGGAAACCAAGCGCAAGATGCTTCTCTATAGACGATTATTG
TGCCGTGAGTTGGCACGTGACGGGAAAACTCCCCGGGAGATCGCAAGGGC
TAGAAATCTAACGCTTCAAGAGCAGGATCAGGGCAGGTTTCCGAAGTCCT
GAATAAGTCTATCCATATTCCGCATATTTTATGGCAGAAGAGTTTACGTT
TTTGCACTCAGGAAGAAGTTGTTTCGTCCACTTCTCCTGTTTATTTTGGT
CCTATTTCAATTATAATTAAATGGTTTTTATAAAAAAAAAAAAAAAAA
IP17603.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:09:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-RA | 477 | CG34160-RA | 47..477 | 1..431 | 2155 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:27:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 10578805..10579132 | 104..431 | 1565 | 98.5 | Plus |
chr2L | 23010047 | chr2L | 10578627..10578729 | 1..103 | 515 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10579997..10580328 | 104..435 | 1660 | 100 | Plus |
2L | 23513712 | 2L | 10579819..10579921 | 1..103 | 515 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10579997..10580328 | 104..435 | 1660 | 100 | Plus |
2L | 23513712 | 2L | 10579819..10579921 | 1..103 | 515 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 16:27:26 has no hits.
IP17603.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:28:27 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 10578627..10578729 | 1..103 | 100 | -> | Plus |
chr2L | 10578805..10579132 | 104..431 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:46 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 1..216 | 87..302 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:12:48 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 1..216 | 87..302 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:51 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 1..216 | 87..302 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:22:57 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 1..216 | 87..302 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:28:38 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 1..216 | 87..302 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:41:33 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 11..441 | 1..431 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:12:48 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 11..441 | 1..431 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:51 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 67..497 | 1..431 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:22:57 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 11..441 | 1..431 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:28:38 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34160-RA | 67..497 | 1..431 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:27 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10579819..10579921 | 1..103 | 100 | -> | Plus |
2L | 10579997..10580324 | 104..431 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:27 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10579819..10579921 | 1..103 | 100 | -> | Plus |
2L | 10579997..10580324 | 104..431 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:27 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10579819..10579921 | 1..103 | 100 | -> | Plus |
2L | 10579997..10580324 | 104..431 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:51 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10579819..10579921 | 1..103 | 100 | -> | Plus |
arm_2L | 10579997..10580324 | 104..431 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:44:15 Download gff for
IP17603.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10579819..10579921 | 1..103 | 100 | -> | Plus |
2L | 10579997..10580324 | 104..431 | 100 | | Plus |
IP17603.pep Sequence
Translation from 86 to 301
> IP17603.pep
MSNNKASSSRGRHPGMQFSTAMGTPETKRKMLLYRRLLCRELARDGKTPR
EIARARNLTLQEQDQGRFPKS*
IP17603.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:02:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15808-PA | 72 | GF15808-PA | 6..71 | 5..70 | 265 | 78.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:02:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23654-PA | 71 | GG23654-PA | 1..71 | 1..71 | 291 | 83.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-PA | 71 | CG34160-PA | 1..71 | 1..71 | 365 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:02:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI23359-PA | 64 | GI23359-PA | 1..60 | 1..63 | 145 | 49.2 | Plus |
IP17603.hyp Sequence
Translation from 86 to 301
> IP17603.hyp
MSNNKASSSRGRHPGMQFSTAMGTPETKRKMLLYRRLLCRELARDGKTPR
EIARARNLTLQEQDQGRFPKS*
IP17603.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:44:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34160-PA | 71 | CG34160-PA | 1..71 | 1..71 | 365 | 100 | Plus |