Clone IP17603 Report

Search the DGRC for IP17603

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:176
Well:3
Vector:pOT2
Associated Gene/TranscriptCG34160-RA
Protein status:IP17603.pep: gold
Sequenced Size:448

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34160 2008-04-29 Release 5.5 accounting
CG34160 2008-08-15 Release 5.9 accounting
CG34160 2008-12-18 5.12 accounting

Clone Sequence Records

IP17603.complete Sequence

448 bp assembled on 2007-01-15

GenBank Submission: BT030145

> IP17603.complete
CAAAGGTCGCATTTTAGTTTTCCAAATTCCCCCGAAATTATAACGTAAGC
TCTTTGGCTGGACTTTTCAAAATTGATAAACCAAAAATGTCCAACAACAA
GGCATCCTCTTCCCGAGGCCGACATCCTGGGATGCAGTTCAGCACTGCCA
TGGGAACGCCGGAAACCAAGCGCAAGATGCTTCTCTATAGACGATTATTG
TGCCGTGAGTTGGCACGTGACGGGAAAACTCCCCGGGAGATCGCAAGGGC
TAGAAATCTAACGCTTCAAGAGCAGGATCAGGGCAGGTTTCCGAAGTCCT
GAATAAGTCTATCCATATTCCGCATATTTTATGGCAGAAGAGTTTACGTT
TTTGCACTCAGGAAGAAGTTGTTTCGTCCACTTCTCCTGTTTATTTTGGT
CCTATTTCAATTATAATTAAATGGTTTTTATAAAAAAAAAAAAAAAAA

IP17603.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-RA 477 CG34160-RA 47..477 1..431 2155 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10578805..10579132 104..431 1565 98.5 Plus
chr2L 23010047 chr2L 10578627..10578729 1..103 515 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10579997..10580328 104..435 1660 100 Plus
2L 23513712 2L 10579819..10579921 1..103 515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10579997..10580328 104..435 1660 100 Plus
2L 23513712 2L 10579819..10579921 1..103 515 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:27:26 has no hits.

IP17603.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:28:27 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10578627..10578729 1..103 100 -> Plus
chr2L 10578805..10579132 104..431 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:46 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 1..216 87..302 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:12:48 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 1..216 87..302 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:51 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 1..216 87..302 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:22:57 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 1..216 87..302 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:28:38 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 1..216 87..302 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:41:33 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 11..441 1..431 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:12:48 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 11..441 1..431 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:51 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 67..497 1..431 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:22:57 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 11..441 1..431 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:28:38 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
CG34160-RA 67..497 1..431 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:27 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10579819..10579921 1..103 100 -> Plus
2L 10579997..10580324 104..431 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:27 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10579819..10579921 1..103 100 -> Plus
2L 10579997..10580324 104..431 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:27 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10579819..10579921 1..103 100 -> Plus
2L 10579997..10580324 104..431 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:51 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10579819..10579921 1..103 100 -> Plus
arm_2L 10579997..10580324 104..431 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:44:15 Download gff for IP17603.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10579819..10579921 1..103 100 -> Plus
2L 10579997..10580324 104..431 100   Plus

IP17603.pep Sequence

Translation from 86 to 301

> IP17603.pep
MSNNKASSSRGRHPGMQFSTAMGTPETKRKMLLYRRLLCRELARDGKTPR
EIARARNLTLQEQDQGRFPKS*

IP17603.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15808-PA 72 GF15808-PA 6..71 5..70 265 78.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23654-PA 71 GG23654-PA 1..71 1..71 291 83.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-PA 71 CG34160-PA 1..71 1..71 365 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23359-PA 64 GI23359-PA 1..60 1..63 145 49.2 Plus

IP17603.hyp Sequence

Translation from 86 to 301

> IP17603.hyp
MSNNKASSSRGRHPGMQFSTAMGTPETKRKMLLYRRLLCRELARDGKTPR
EIARARNLTLQEQDQGRFPKS*

IP17603.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34160-PA 71 CG34160-PA 1..71 1..71 365 100 Plus