IP17609.complete Sequence
489 bp assembled on 2007-01-15
GenBank Submission: BT030147
> IP17609.complete
ATTGTTCGCTTGAGGAATATTTTCAATATTCAACATGAAATTCACGATAA
TCGTTTTTGTTGCGCTCCTCGCCTTTGCATCGGCCCAGTTCGGTCCGTTT
GGTCAAATTATTAGGGGTATTGAACGATTTGAAGGTGGTCTGCAACAACA
ACAGCAGCAGCAGCAAAGCGGCTTTGGCGGTGGTCAGCAGCAGCAACAGC
AGGAGGAGGGTGTCATCTTCAGAGGTCCTTTCGGCGGCGGAGTGGAGTTC
TTCCAGGAGCAACAGCAGCAGCAGCAAGGCGGTGGAGGTCAGCAGCAACA
GCAGCAGGAGAACCTATTTAACTTCTTCGGCTAAAGCTCCTTAGTGAGGG
AAACTAGACATAGACTGACCACTATCTATAGAACTCAAAAGCAAGCCATT
AACTAAAGCCATGATCGTAGAGATAAACACACGATAAATAAATATTTTTA
AAAACACACAATTATAAACCAAAAAAAAAAAAAAAAAAA
IP17609.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:09:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-RA | 797 | CG34165-RA | 159..630 | 1..472 | 2360 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:40:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 14712618..14713042 | 46..470 | 2125 | 100 | Plus |
chr2L | 23010047 | chr2L | 14712482..14712527 | 1..46 | 230 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14713931..14714357 | 46..472 | 2135 | 100 | Plus |
2L | 23513712 | 2L | 14713795..14713840 | 1..46 | 230 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 14713931..14714357 | 46..472 | 2135 | 100 | Plus |
2L | 23513712 | 2L | 14713795..14713840 | 1..46 | 230 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 00:40:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy5 | 7369 | gypsy5 GYPSY5 7369bp | 522..563 | 424..464 | 126 | 81 | Plus |
Tc1-2 | 1644 | Tc1-2 TC1-2 1644bp | 482..517 | 434..469 | 108 | 77.8 | Plus |
IP17609.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:40:53 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 14712482..14712527 | 1..46 | 100 | -> | Plus |
chr2L | 14712619..14712713 | 47..141 | 100 | == | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:08:51 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 1..300 | 35..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:12:52 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 1..300 | 35..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:51 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 1..300 | 35..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:23:06 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:08:37 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 1..300 | 35..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:41:36 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 1..300 | 35..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:12:52 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 19..488 | 1..470 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:51 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 46..515 | 1..470 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 15:23:06 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:08:37 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34165-RA | 46..515 | 1..470 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:53 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14713795..14713840 | 1..46 | 100 | -> | Plus |
2L | 14713932..14714355 | 47..470 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:53 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14713795..14713840 | 1..46 | 100 | -> | Plus |
2L | 14713932..14714355 | 47..470 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:53 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14713795..14713840 | 1..46 | 100 | -> | Plus |
2L | 14713932..14714355 | 47..470 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:51 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 14713932..14714355 | 47..470 | 100 | | Plus |
arm_2L | 14713795..14713840 | 1..46 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:44:18 Download gff for
IP17609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 14713795..14713840 | 1..46 | 100 | -> | Plus |
2L | 14713932..14714355 | 47..470 | 100 | | Plus |
IP17609.hyp Sequence
Translation from 34 to 333
> IP17609.hyp
MKFTIIVFVALLAFASAQFGPFGQIIRGIERFEGGLQQQQQQQQSGFGGG
QQQQQQEEGVIFRGPFGGGVEFFQEQQQQQQGGGGQQQQQQENLFNFFG*
IP17609.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:44:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-PB | 99 | CG34165-PB | 1..99 | 1..99 | 514 | 100 | Plus |
CG34165-PA | 99 | CG34165-PA | 1..99 | 1..99 | 514 | 100 | Plus |
CG31775-PB | 89 | CG31775-PB | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG31775-PA | 89 | CG31775-PA | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG42586-PB | 89 | CG42586-PB | 1..87 | 1..92 | 183 | 51.5 | Plus |
IP17609.pep Sequence
Translation from 34 to 333
> IP17609.pep
MKFTIIVFVALLAFASAQFGPFGQIIRGIERFEGGLQQQQQQQQSGFGGG
QQQQQQEEGVIFRGPFGGGVEFFQEQQQQQQGGGGQQQQQQENLFNFFG*
IP17609.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:03:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14891-PA | 97 | GF14891-PA | 1..97 | 1..99 | 143 | 76 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:03:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG25125-PA | 101 | GG25125-PA | 1..101 | 1..99 | 188 | 78.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34165-PB | 99 | CG34165-PB | 1..99 | 1..99 | 514 | 100 | Plus |
CG34165-PA | 99 | CG34165-PA | 1..99 | 1..99 | 514 | 100 | Plus |
CG42586-PB | 89 | CG42586-PB | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG42586-PA | 89 | CG42586-PA | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG31775-PB | 89 | CG31775-PB | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG31775-PA | 89 | CG31775-PA | 1..87 | 1..92 | 183 | 51.5 | Plus |
CG15282-PB | 79 | CG15282-PB | 1..77 | 1..83 | 161 | 54.1 | Plus |
CG15282-PC | 79 | CG15282-PC | 1..77 | 1..83 | 161 | 54.1 | Plus |
CG15282-PA | 79 | CG15282-PA | 1..77 | 1..83 | 161 | 54.1 | Plus |
CG4440-PB | 79 | CG4440-PB | 1..76 | 1..99 | 131 | 42.6 | Plus |
CG4440-PA | 79 | CG4440-PA | 1..76 | 1..99 | 131 | 42.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:03:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15721-PA | 98 | GM15721-PA | 1..98 | 1..99 | 407 | 97 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:03:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23973-PA | 99 | GD23973-PA | 1..99 | 1..99 | 425 | 100 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:03:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19042-PA | 99 | GE19042-PA | 1..99 | 1..99 | 170 | 88 | Plus |