Clone IP17640 Report

Search the DGRC for IP17640

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:176
Well:40
Vector:pOT2
Associated Gene/TranscriptCG34132-RA
Protein status:IP17640.pep: gold
Sequenced Size:462

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34132 2008-04-29 Release 5.5 accounting
CG34132 2008-08-15 Release 5.9 accounting
CG34132 2008-12-18 5.12 accounting

Clone Sequence Records

IP17640.complete Sequence

462 bp assembled on 2007-01-15

GenBank Submission: BT029959

> IP17640.complete
CCATTTATTCATAGCTGAATTAAACTATAGTTTATAAAGAAAACCAAACA
AATGGCTATGGCTAATGTGGACAAAGGTGAACTTATGGACCAGGTTAAGC
AACAGATTGCTGTTGCGAATGCCCAGGAATTGCTCACGCAAATGACCGAA
AAGTGCTTCAAAAAATGTGTCAATAAGCCGGGAACTTCCCTCGATTCGTC
CGAACAGAAATGCATTTCCATGTGCATGGACCGGTTTATGGACTCGTGGA
ACCTCATTTCTCGGGTGTACGGCCAAAGAATACAACGTGAACAATCCAAG
TTCTAAACACACGAATCGGCTTCTGCATTTTGGAGCAGCTTGGGACTAAC
TATATCTGCCAGCTATTGATTAGTTGTTATATCTAAAGTTTGATAATGCA
ATAAAAACATGCATTGCGTGTTACGTGATTCTGATAACACAAAAAAAAAA
AAAAAAAAAAAA

IP17640.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-RA 674 CG34132-RA 111..552 1..442 2210 100 Plus
Tim13-RA 442 Tim13-RA 106..289 68..251 260 76 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7884912..7885146 206..440 1175 100 Plus
chr2L 23010047 chr2L 7884635..7884841 1..207 1035 100 Plus
chr3L 24539361 chr3L 11765112..11765295 251..68 260 76.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:32:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7885875..7886111 206..442 1185 100 Plus
2L 23513712 2L 7885598..7885804 1..207 1035 100 Plus
3L 28110227 3L 11774213..11774396 251..68 260 76.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7885875..7886111 206..442 1185 100 Plus
2L 23513712 2L 7885598..7885804 1..207 1035 100 Plus
3L 28103327 3L 11767313..11767496 251..68 260 76 Minus
Blast to na_te.dros performed 2019-03-16 14:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 5103..5150 288..335 114 70.8 Plus

IP17640.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:38:43 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7884635..7884841 1..207 100 -> Plus
chr2L 7884914..7885146 208..440 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:09:02 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..255 52..306 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:12:59 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..255 52..306 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:28:11 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..255 52..306 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:23:13 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..255 52..306 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:58 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..255 52..306 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:41:42 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:12:59 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:11 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 96..535 1..440 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:23:13 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 1..294 52..345 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:58 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
CG34132-RA 96..535 1..440 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:43 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7885598..7885804 1..207 100 -> Plus
2L 7885877..7886109 208..440 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:43 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7885598..7885804 1..207 100 -> Plus
2L 7885877..7886109 208..440 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:43 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7885598..7885804 1..207 100 -> Plus
2L 7885877..7886109 208..440 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:11 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7885877..7886109 208..440 100   Plus
arm_2L 7885598..7885804 1..207 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:44:23 Download gff for IP17640.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7885598..7885804 1..207 100 -> Plus
2L 7885877..7886109 208..440 100   Plus

IP17640.pep Sequence

Translation from 51 to 305

> IP17640.pep
MAMANVDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSS
EQKCISMCMDRFMDSWNLISRVYGQRIQREQSKF*

IP17640.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21863-PA 84 GF21863-PA 1..84 1..84 420 92.9 Plus
Dana\GF24514-PA 92 GF24514-PA 1..83 1..83 343 71.1 Plus
Dana\GF21719-PA 85 GF21719-PA 13..80 13..80 199 45.6 Plus
Dana\GF19075-PA 89 GF19075-PA 20..82 15..79 134 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13890-PA 93 GG13890-PA 1..83 1..83 345 72.3 Plus
Dere\GG18412-PA 87 GG18412-PA 19..81 15..79 131 36.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10210-PA 82 GH10210-PA 1..81 3..83 377 84 Plus
Dgri\GH16382-PA 92 GH16382-PA 1..83 1..83 300 59 Plus
Dgri\GH11842-PA 85 GH11842-PA 9..82 10..83 231 55.4 Plus
Dgri\GH12183-PA 88 GH12183-PA 25..85 22..82 129 37.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-PA 84 CG34132-PA 1..84 1..84 435 100 Plus
Tim13-PA 92 CG11611-PA 1..81 1..81 350 76.5 Plus
CG42302-PA 121 CG42302-PA 8..77 12..81 175 44.3 Plus
Tim8-PB 88 CG1728-PB 20..82 15..79 135 38.5 Plus
Tim8-PA 88 CG1728-PA 20..82 15..79 135 38.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14974-PA 84 GI14974-PA 1..82 1..82 395 87.8 Plus
Dmoj\GI11575-PA 91 GI11575-PA 1..82 1..82 314 62.2 Plus
Dmoj\GI14322-PA 87 GI14322-PA 4..84 3..83 236 53.1 Plus
Dmoj\GI14992-PA 83 GI14992-PA 10..81 9..80 213 48.6 Plus
Dmoj\GI14321-PA 105 GI14321-PA 15..91 4..80 194 44.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20826-PA 92 GL20826-PA 12..85 10..83 318 73 Plus
Dper\GL18649-PA 56 GL18649-PA 1..56 1..56 247 85.7 Plus
Dper\GL19513-PA 84 GL19513-PA 25..84 22..81 131 40 Plus
Dper\GL14853-PA 86 GL14853-PA 21..84 15..80 130 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25739-PA 94 GA25739-PA 1..94 1..84 388 79.8 Plus
Dpse\GA11098-PA 92 GA11098-PA 12..85 10..83 321 74.3 Plus
Dpse\GA24508-PA 111 GA24508-PA 19..87 12..80 156 36.2 Plus
Dpse\GA27814-PA 470 GA27814-PA 376..453 10..83 137 34.6 Plus
Dpse\GA14436-PA 86 GA14436-PA 21..84 15..80 130 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24714-PA 93 GM24714-PA 1..83 1..83 356 74.7 Plus
Dsec\GM11476-PA 88 GM11476-PA 20..82 15..79 134 38.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12777-PA 93 GD12777-PA 1..83 1..83 356 74.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17233-PA 83 GJ17233-PA 4..83 5..84 389 87.5 Plus
Dvir\GJ11254-PA 92 GJ11254-PA 1..81 1..81 312 64.2 Plus
Dvir\GJ19379-PA 87 GJ19379-PA 5..84 4..83 248 53.8 Plus
Dvir\GJ15348-PA 68 GJ15348-PA 1..67 15..81 199 49.3 Plus
Dvir\GJ15242-PA 88 GJ15242-PA 20..85 15..82 138 38.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11560-PA 120 GK11560-PA 1..79 1..79 386 88.6 Plus
Dwil\GK12379-PA 720 GK12379-PA 1..77 3..79 275 61 Plus
Dwil\GK10163-PA 87 GK10163-PA 10..80 10..80 254 57.7 Plus
Dwil\GK21816-PA 88 GK21816-PA 20..86 15..83 151 40.6 Plus
Dwil\GK25334-PA 88 GK25334-PA 20..85 15..82 134 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20181-PA 93 GE20181-PA 1..83 1..83 354 74.7 Plus
Dyak\GE15496-PA 125 GE15496-PA 8..69 12..73 171 46.8 Plus
Dyak\GE15929-PA 88 GE15929-PA 20..82 15..79 134 38.5 Plus

IP17640.hyp Sequence

Translation from 51 to 305

> IP17640.hyp
MAMANVDKGELMDQVKQQIAVANAQELLTQMTEKCFKKCVNKPGTSLDSS
EQKCISMCMDRFMDSWNLISRVYGQRIQREQSKF*

IP17640.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34132-PA 84 CG34132-PA 1..84 1..84 435 100 Plus
Tim13-PA 92 CG11611-PA 1..81 1..81 350 76.5 Plus
CG42302-PA 121 CG42302-PA 8..77 12..81 175 44.3 Plus
Tim8-PB 88 CG1728-PB 20..82 15..79 135 38.5 Plus
Tim8-PA 88 CG1728-PA 20..82 15..79 135 38.5 Plus