Clone IP17651 Report

Search the DGRC for IP17651

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:176
Well:51
Vector:pOT2
Associated Gene/TranscriptCG12963-RE
Protein status:IP17651.pep: gold
Sequenced Size:847

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12963 2008-04-29 Release 5.5 accounting
CG12963 2008-08-15 Release 5.9 accounting
CG12963 2008-12-18 5.12 accounting

Clone Sequence Records

IP17651.complete Sequence

847 bp assembled on 2007-01-15

GenBank Submission: BT029960

> IP17651.complete
TTTTCATGGAGCGAATAACATCGCCGGTGCTCGCGTATCCACGTGGATAT
ACCGAATTTTCGGATCACAAAATGTCGAATATACCGCCGTATTTGGTGTT
CTTCTTCCTGGCCTTCATTTCCTGTGCGGTCACCTTCTGCTGCCTGAGAT
TCTGCATTTGGGTGTGCTTCGAGGCCAGGGATTCCAGGAGTCGCAGACGC
CGACATGATCGTAATGTATTCAACGCACAGGAGGATCCTTCATCGAACCG
CTATGGCGACATTTTCTTCATCGAACCCGGCAGCGTGGAGGCCAACCGCA
TTCGCGATCAACTGGAAAAGGATGAAAAGGATTTACCCAGCTACGACGAG
GTGATGCGCATGTGTAACCTGACCACTCCCACAGCAGCAGCGGCTGGAAT
GCCTGTTCCCCAATCGCCCCTCGGTGTACCCAGTCCCATTGGAATCGCGG
CACTGCCGGCGCCACCGTATTCGGAGACAGATCCACATTCCTCGTCCGCC
GCAGAAGCCACTGTCATCGCAATGGAACCGATGGAGCCATCCACCTCCCG
CGCGGCACAGATTCCACCCAGCTCCGGATCTGGTCCTCCTGCTCCATTGC
CAACGACAGCGGTGTGATCCGTCGGAGGCATGGATAAATTGGAACTGAAG
CATTCGCCGTGCCACTCTGGGCCACACAGATGCCACTTTGTGTGCGCTTT
CAGTACAGAAATGAACTTGTGTGATCTTATTGAGTACATACCTATTTAAG
TTCTAGACATTAGGAGTCGCATATTGTAAATATATATTTTTAGGACATAG
GATGAAAATTAAAGTGAATTATTTAATTGAAAAAAAAAAAAAAAAAA

IP17651.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963-RE 1135 CG12963-RE 185..1017 1..833 4165 100 Plus
CG12963.j 1478 CG12963.j 733..1360 206..833 3140 100 Plus
CG12963-RC 944 CG12963-RC 194..821 206..833 3140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11448966..11449588 207..829 3115 100 Plus
chr2R 21145070 chr2R 11446667..11446873 1..207 1020 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15561814..15562440 207..833 3135 100 Plus
2R 25286936 2R 15559516..15559722 1..207 1035 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:03:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15563013..15563639 207..833 3135 100 Plus
2R 25260384 2R 15560715..15560921 1..207 1035 100 Plus
Blast to na_te.dros performed 2019-03-15 18:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 3427..3468 321..280 111 73.8 Minus

IP17651.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:13:12 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11446667..11446873 1..207 99 -> Plus
chr2R 11448967..11449588 208..829 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:09:04 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RD 139..561 196..617 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:12:37 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RE 1..612 6..617 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:40 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RE 1..612 6..617 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:22:43 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RD 139..561 196..617 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:55:13 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RE 1..612 6..617 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:41:22 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RB 555..1179 204..829 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:12:37 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RE 4..832 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:40 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RE 280..1108 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:22:44 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RB 555..1179 204..829 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:55:13 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
CG12963-RE 280..1108 1..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:12 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15559516..15559722 1..207 100 -> Plus
2R 15561815..15562436 208..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:12 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15559516..15559722 1..207 100 -> Plus
2R 15561815..15562436 208..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:13:12 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15559516..15559722 1..207 100 -> Plus
2R 15561815..15562436 208..829 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:40 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11447021..11447227 1..207 100 -> Plus
arm_2R 11449320..11449941 208..829 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:44:07 Download gff for IP17651.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15560715..15560921 1..207 100 -> Plus
2R 15563014..15563635 208..829 100   Plus

IP17651.pep Sequence

Translation from 2 to 616

> IP17651.pep
FMERITSPVLAYPRGYTEFSDHKMSNIPPYLVFFFLAFISCAVTFCCLRF
CIWVCFEARDSRSRRRRHDRNVFNAQEDPSSNRYGDIFFIEPGSVEANRI
RDQLEKDEKDLPSYDEVMRMCNLTTPTAAAAGMPVPQSPLGVPSPIGIAA
LPAPPYSETDPHSSSAAEATVIAMEPMEPSTSRAAQIPPSSGSGPPAPLP
TTAV*

IP17651.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11144-PA 191 GF11144-PA 5..173 33..187 442 61 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20536-PA 307 GG20536-PA 172..307 70..204 544 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19971-PA 172 GH19971-PA 56..164 74..184 246 55 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963-PE 203 CG12963-PE 1..203 2..204 1077 100 Plus
CG12963-PH 197 CG12963-PH 7..197 30..204 738 76.4 Plus
CG12963-PJ 179 CG12963-PJ 11..179 36..204 727 85.5 Plus
CG12963-PI 179 CG12963-PI 7..179 34..204 722 83.8 Plus
CG12963-PD 186 CG12963-PD 38..186 56..204 722 93.3 Plus
CG12963-PL 169 CG12963-PL 29..169 64..204 720 98.6 Plus
CG12963-PC 178 CG12963-PC 8..178 30..204 715 82.3 Plus
CG12963-PM 176 CG12963-PM 12..176 48..204 712 86.1 Plus
CG12963-PF 208 CG12963-PF 24..208 31..204 709 79.5 Plus
CG12963-PN 180 CG12963-PN 11..180 32..204 708 82.1 Plus
CG12963-PA 190 CG12963-PA 50..190 64..204 707 97.2 Plus
CG12963-PK 200 CG12963-PK 65..200 69..204 706 100 Plus
CG12963-PG 213 CG12963-PG 78..213 69..204 706 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20257-PA 258 GI20257-PA 147..256 82..187 285 67 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20080-PA 201 GL20080-PA 61..196 73..203 368 66.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11943-PC 201 GA11943-PC 1..196 24..203 513 61 Plus
Dpse\GA11943-PE 190 GA11943-PE 7..185 30..203 416 53.6 Plus
Dpse\GA11943-PG 180 GA11943-PG 5..175 32..203 402 55.2 Plus
Dpse\GA11943-PF 193 GA11943-PF 13..188 33..203 396 54.4 Plus
Dpse\GA11943-PB 197 GA11943-PB 50..192 66..203 388 63.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21627-PA 190 GM21627-PA 50..190 64..204 658 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11129-PA 190 GD11129-PA 26..190 38..204 673 81.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20211-PA 171 GJ20211-PA 2..170 30..188 339 50.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23031-PA 206 GK23031-PA 2..192 16..193 336 49.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11720-PA 424 GE11720-PA 289..424 69..204 539 89 Plus
Dyak\GE11720-PA 424 GE11720-PA 139..206 1..68 317 83.8 Plus

IP17651.hyp Sequence

Translation from 2 to 616

> IP17651.hyp
FMERITSPVLAYPRGYTEFSDHKMSNIPPYLVFFFLAFISCAVTFCCLRF
CIWVCFEARDSRSRRRRHDRNVFNAQEDPSSNRYGDIFFIEPGSVEANRI
RDQLEKDEKDLPSYDEVMRMCNLTTPTAAAAGMPVPQSPLGVPSPIGIAA
LPAPPYSETDPHSSSAAEATVIAMEPMEPSTSRAAQIPPSSGSGPPAPLP
TTAV*

IP17651.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12963-PE 203 CG12963-PE 1..203 2..204 1077 100 Plus
CG12963-PH 197 CG12963-PH 7..197 30..204 738 76.4 Plus
CG12963-PJ 179 CG12963-PJ 11..179 36..204 727 85.5 Plus
CG12963-PI 179 CG12963-PI 7..179 34..204 722 83.8 Plus
CG12963-PD 186 CG12963-PD 38..186 56..204 722 93.3 Plus