Clone IP17678 Report

Search the DGRC for IP17678

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:176
Well:78
Vector:pOT2
Associated Gene/TranscriptCG34219-RA
Protein status:IP17678.pep: gold
Sequenced Size:1109

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34219 2008-04-29 Release 5.5 accounting
CG34219 2008-08-15 Release 5.9 accounting
CG34219 2008-12-18 5.12 accounting

Clone Sequence Records

IP17678.complete Sequence

1109 bp assembled on 2007-01-16

GenBank Submission: BT030153

> IP17678.complete
CAATCCTCTGCGATCCTCTCTCACCCCGAATCCCAAACTGACCGCTCTAC
ATTTCCCCAATGCATGCCAAAAGTGGATGAGTCCCCCATCTTCCGGCGCA
AGCATATAATCAGCGAGGAGCGTTCCGTATCTGTGGATCGCTTCAAGTAC
ACGCTAAACGATGAGGGAGGCTTCACCAGGTCCGTTCCGCTGGTTCAGGA
GTATCACTACAGGGTGGTATCTCCTTTGGCCAGCCGACCCAGTCAGCAGC
ATCCGCATAAGCCGGGATCCGGAGAAGCCCGTTTCGAGCCTCGTCTTAAC
CGTCGCTCCTCGGTTCCGATCAGCATTAACTATCAAACGGTGCACGTATC
GAGTCCACATCCTCCGGAAATGGCCAGGCGCGGCTCGGTGATAAGCCTCA
CTGGGCCACCACCAGAAGTCAGTGGTATGCCAAGTGGAGCCGCTGATCCA
AAGCGGCGCGTCCGCATGATAAATCGCCATTGAAGTCCAGAAGTCCAGAT
GAGATCAGGACACAGCCCAACGAAATTGCAAAGAGACTACAGTATTTTAA
CACACCATTCGGAAACAGAAACCGCACACGTTGTAGTCCTTCTTAATGCG
TTTCTTTTAATCAGTTAATTATGTTATATTATTCAAGTGTTTTAAAAAAA
CGTACAAAGAATATTCTTCTCGAAGACACCGAATTTACGCCCACTTCGGC
GGGCAGCCGTTTGCCGCAGCATTTTGCCATCCTATTGTACATTATTCTAC
TTAGGGCAAGATTAAAAAAATCTTAGGCTAGCGTAGTGTTTAGTTTGGAA
TTCAGTACCTATGATATAACCATTATCTACGAACTAACTACGAACTTGTG
ATGCTCATTACAATTACAATGACAATTACATACAGCTGGGTATGTATCTG
GGTTGAAAGACCTGCTGGGCGAAGCGGATGAAGAGGGTGCAAGATCTTAA
CTACGGTTGACGCGCTACTGGATCGGGGTGCGGAGTTATGGTCGGAGTGG
TTGGTCCCTACGGCTAATACACGTATTCTACAAGGCCTCCATCTTCATCG
AATTTTGCGCTAGTTTCTCCTATTCCATTAAATATTAAAATAAAAAAAAA
AAAAAAAAA

IP17678.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34219-RA 1196 CG34219-RA 93..1186 1..1094 5470 100 Plus
lin.b 3667 lin.b 3133..3667 1094..560 2675 100 Minus
lin-RA 3675 lin-RA 3141..3675 1094..560 2675 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4805279..4806084 1091..286 4030 100 Minus
chr2R 21145070 chr2R 4806143..4806428 286..1 1430 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 18:33:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8917725..8918533 1094..286 4045 100 Minus
2R 25286936 2R 8918592..8918877 286..1 1430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8918924..8919732 1094..286 4045 100 Minus
2R 25260384 2R 8919791..8920076 286..1 1430 100 Minus
Blast to na_te.dros performed 2019-03-16 14:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Tc3 1743 Tc3 TC3 1743bp 227..279 660..607 122 76.4 Minus

IP17678.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:39:58 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4805294..4806083 287..1076 100 <- Minus
chr2R 4806143..4806428 1..286 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 18:09:10 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 1..420 64..483 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:09:39 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 1..420 64..483 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:28:26 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 1..420 64..483 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:19:51 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 1..420 64..483 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:34:12 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 1..420 64..483 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:38:35 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 93..1183 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:09:39 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 93..1183 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:28:26 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 1..1091 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:19:51 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 93..1183 1..1091 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:12 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
CG34219-RA 1..1091 1..1091 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:58 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8917728..8918532 287..1091 100 <- Minus
2R 8918592..8918877 1..286 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:58 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8917728..8918532 287..1091 100 <- Minus
2R 8918592..8918877 1..286 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:58 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8917728..8918532 287..1091 100 <- Minus
2R 8918592..8918877 1..286 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:28:26 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4805233..4806037 287..1091 100 <- Minus
arm_2R 4806097..4806382 1..286 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:42:01 Download gff for IP17678.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8918927..8919731 287..1091 100 <- Minus
2R 8919791..8920076 1..286 100   Minus

IP17678.pep Sequence

Translation from 0 to 482

> IP17678.pep
QSSAILSHPESQTDRSTFPQCMPKVDESPIFRRKHIISEERSVSVDRFKY
TLNDEGGFTRSVPLVQEYHYRVVSPLASRPSQQHPHKPGSGEARFEPRLN
RRSSVPISINYQTVHVSSPHPPEMARRGSVISLTGPPPEVSGMPSGAADP
KRRVRMINRH*

IP17678.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12991-PA 349 GF12991-PA 211..349 24..160 383 59 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10609-PA 142 GG10609-PA 4..142 24..160 587 85 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22685-PA 335 GH22685-PA 207..335 33..160 167 42.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG34219-PB 139 CG34219-PB 1..139 22..160 730 100 Plus
CG34219-PA 139 CG34219-PA 1..139 22..160 730 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20928-PB 355 GA20928-PB 221..355 25..160 364 59.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20654-PA 144 GM20654-PA 4..144 24..160 650 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10128-PA 143 GD10128-PA 1..143 22..160 596 85.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10753-PA 322 GK10753-PA 200..322 26..160 187 39.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22719-PA 141 GE22719-PA 4..141 24..160 558 83.6 Plus

IP17678.hyp Sequence

Translation from 0 to 482

> IP17678.hyp
QSSAILSHPESQTDRSTFPQCMPKVDESPIFRRKHIISEERSVSVDRFKY
TLNDEGGFTRSVPLVQEYHYRVVSPLASRPSQQHPHKPGSGEARFEPRLN
RRSSVPISINYQTVHVSSPHPPEMARRGSVISLTGPPPEVSGMPSGAADP
KRRVRMINRH*

IP17678.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34219-PB 139 CG34219-PB 1..139 22..160 730 100 Plus
CG34219-PA 139 CG34219-PA 1..139 22..160 730 100 Plus